BLASTX nr result
ID: Scutellaria22_contig00025783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025783 (950 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323912.1| predicted protein [Populus trichocarpa] gi|2... 57 5e-06 ref|XP_002524849.1| nucleic acid binding protein, putative [Rici... 57 8e-06 >ref|XP_002323912.1| predicted protein [Populus trichocarpa] gi|222866914|gb|EEF04045.1| predicted protein [Populus trichocarpa] Length = 197 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 829 MGKNQAYKAMQRSRLGSSSAGTEEAEDGMV 740 MGKNQAYKAMQRSRLGSSSAG EE EDGMV Sbjct: 1 MGKNQAYKAMQRSRLGSSSAGPEEIEDGMV 30 >ref|XP_002524849.1| nucleic acid binding protein, putative [Ricinus communis] gi|223535812|gb|EEF37473.1| nucleic acid binding protein, putative [Ricinus communis] Length = 199 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 829 MGKNQAYKAMQRSRLGSSSAGTEEAEDGMV 740 MGKNQAYKAMQR+RLGSSSAG EE EDGMV Sbjct: 1 MGKNQAYKAMQRARLGSSSAGPEEVEDGMV 30