BLASTX nr result
ID: Scutellaria22_contig00025570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025570 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002867945.1| predicted protein [Arabidopsis lyrata subsp.... 55 8e-06 >ref|XP_002867945.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313781|gb|EFH44204.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 180 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +1 Query: 1 LIGLLEKAEEQKRKLKARIELLKKEKQDFSGAANLVQELRTRIKNYETG 147 L GLL++AEEQ R+ +ARI LLKK+ QDFSG + V++L+ R Y G Sbjct: 125 LTGLLQRAEEQNRQKEARISLLKKQTQDFSGTTDRVEKLKARFSGYFEG 173