BLASTX nr result
ID: Scutellaria22_contig00025526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025526 (607 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521083.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_003626974.1| hypothetical protein MTR_8g013640 [Medicago ... 60 3e-07 ref|XP_003548682.1| PREDICTED: uncharacterized protein LOC100818... 60 4e-07 ref|XP_002265149.1| PREDICTED: uncharacterized protein LOC100262... 58 1e-06 emb|CBI25688.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_002521083.1| conserved hypothetical protein [Ricinus communis] gi|223539652|gb|EEF41234.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -2 Query: 405 KSSQRGNQRERDREMALARAANKHKNTKDDGLTPEQRRKR 286 K S+RGNQRERDRE A ARA K KN KDDGLTPEQRR+R Sbjct: 8 KESERGNQRERDRERAQARAGQKPKNPKDDGLTPEQRRER 47 >ref|XP_003626974.1| hypothetical protein MTR_8g013640 [Medicago truncatula] gi|355520996|gb|AET01450.1| hypothetical protein MTR_8g013640 [Medicago truncatula] Length = 199 Score = 60.1 bits (144), Expect = 3e-07 Identities = 39/74 (52%), Positives = 45/74 (60%), Gaps = 12/74 (16%) Frame = -2 Query: 471 PTKLKPEPLP-----SLVDSCSGG----H*RKS---SQRGNQRERDREMALARAANKHKN 328 P P PLP +L+DS S + R S S RGNQRERDRE A ARA K K Sbjct: 96 PLYFTPSPLPFTFTFTLLDSISSPGLLIYARVSLPTSSRGNQRERDRERAQARANQKSKQ 155 Query: 327 TKDDGLTPEQRRKR 286 +K+DGLTPEQRR+R Sbjct: 156 SKNDGLTPEQRRER 169 >ref|XP_003548682.1| PREDICTED: uncharacterized protein LOC100818846 [Glycine max] Length = 147 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -2 Query: 399 SQRGNQRERDREMALARAANKHKNTKDDGLTPEQRRKR 286 SQRGNQRERDRE A ARA K K K+DGLTPEQRR+R Sbjct: 82 SQRGNQRERDRERAQARAGGKTKQPKNDGLTPEQRRER 119 >ref|XP_002265149.1| PREDICTED: uncharacterized protein LOC100262707 [Vitis vinifera] Length = 80 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 402 SSQRGNQRERDREMALARAANKHKNTKDDGLTPEQRRKR 286 S +RGNQR+RDRE A AR +K K KDDGLTPEQRR+R Sbjct: 4 SCERGNQRDRDRERAQARIGHKSKQAKDDGLTPEQRRER 42 >emb|CBI25688.3| unnamed protein product [Vitis vinifera] Length = 107 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 402 SSQRGNQRERDREMALARAANKHKNTKDDGLTPEQRRKR 286 + +RGNQR+RDRE A AR +K K KDDGLTPEQRR+R Sbjct: 31 NDERGNQRDRDRERAQARIGHKSKQAKDDGLTPEQRRER 69