BLASTX nr result
ID: Scutellaria22_contig00025441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025441 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514698.1| conserved hypothetical protein [Ricinus comm... 98 8e-19 ref|NP_564521.1| dolichyl-phosphate mannosyltransferase polypept... 94 1e-17 ref|XP_002891413.1| hypothetical protein ARALYDRAFT_314249 [Arab... 94 2e-17 gb|AFK45261.1| unknown [Medicago truncatula] 93 3e-17 ref|XP_003552128.1| PREDICTED: uncharacterized protein LOC100796... 91 1e-16 >ref|XP_002514698.1| conserved hypothetical protein [Ricinus communis] gi|223546302|gb|EEF47804.1| conserved hypothetical protein [Ricinus communis] Length = 82 Score = 97.8 bits (242), Expect = 8e-19 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +3 Query: 3 PLYFIVSLGCYGLLMVGVGLMCFPTCPHEAILLQKDVVEAKGFLKGKGVDVGTD 164 P+YFI+SLGCYGLLMVG+GLM FPTCP EAILLQ+D+VEAKGFLK KGVDV +D Sbjct: 29 PIYFIISLGCYGLLMVGIGLMQFPTCPQEAILLQQDIVEAKGFLKQKGVDVSSD 82 >ref|NP_564521.1| dolichyl-phosphate mannosyltransferase polypeptide 3 [Arabidopsis thaliana] gi|21553435|gb|AAM62528.1| unknown [Arabidopsis thaliana] gi|26451193|dbj|BAC42700.1| unknown protein [Arabidopsis thaliana] gi|28973443|gb|AAO64046.1| unknown protein [Arabidopsis thaliana] gi|332194132|gb|AEE32253.1| dolichyl-phosphate mannosyltransferase polypeptide 3 [Arabidopsis thaliana] Length = 89 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +3 Query: 3 PLYFIVSLGCYGLLMVGVGLMCFPTCPHEAILLQKDVVEAKGFLKGKGVDVGTD 164 P+YF+VSLGCYGLLMVGVGLM FPTCP EA+LLQKD+ EAK F K KGVDVG++ Sbjct: 36 PIYFVVSLGCYGLLMVGVGLMQFPTCPQEAVLLQKDIAEAKDFFKHKGVDVGSN 89 >ref|XP_002891413.1| hypothetical protein ARALYDRAFT_314249 [Arabidopsis lyrata subsp. lyrata] gi|297337255|gb|EFH67672.1| hypothetical protein ARALYDRAFT_314249 [Arabidopsis lyrata subsp. lyrata] Length = 89 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = +3 Query: 3 PLYFIVSLGCYGLLMVGVGLMCFPTCPHEAILLQKDVVEAKGFLKGKGVDVGTD 164 P+YF+VSLGCYGLLMVG+GLM FPTCP EA+LLQKD+ EAK F K KGVDVG++ Sbjct: 36 PIYFVVSLGCYGLLMVGIGLMQFPTCPQEAVLLQKDIAEAKDFFKHKGVDVGSN 89 >gb|AFK45261.1| unknown [Medicago truncatula] Length = 89 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = +3 Query: 3 PLYFIVSLGCYGLLMVGVGLMCFPTCPHEAILLQKDVVEAKGFLKGKGVDVGT 161 P+YF+VSLGCYGLLMVGVGLM FPTCP EA+LLQKD+VEAK +LK +GVDV T Sbjct: 36 PIYFVVSLGCYGLLMVGVGLMNFPTCPQEALLLQKDIVEAKEYLKQRGVDVST 88 >ref|XP_003552128.1| PREDICTED: uncharacterized protein LOC100796507 [Glycine max] Length = 71 Score = 90.5 bits (223), Expect = 1e-16 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +3 Query: 3 PLYFIVSLGCYGLLMVGVGLMCFPTCPHEAILLQKDVVEAKGFLKGKGVDVGT 161 P+YF+VSLGCYGLLMVG+GLM FPTCP EA+LLQKD+VEAK +L+ KGVDV + Sbjct: 18 PIYFVVSLGCYGLLMVGIGLMNFPTCPQEALLLQKDIVEAKEYLQQKGVDVSS 70