BLASTX nr result
ID: Scutellaria22_contig00025394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025394 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22591.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_004149450.1| PREDICTED: WD repeat-containing protein 91-l... 56 4e-06 >emb|CBI22591.3| unnamed protein product [Vitis vinifera] Length = 663 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +1 Query: 1 RTPALLKISSERDNVNRLKQEIEQLSQKLSQAQTLLEEKDTLLFQLR 141 R PALLKI SE++ VNRLK++I+QL+ KLSQ Q LLEEK+ LFQ R Sbjct: 172 RIPALLKICSEKNTVNRLKKDIKQLNLKLSQLQALLEEKEAQLFQSR 218 >ref|XP_004149450.1| PREDICTED: WD repeat-containing protein 91-like [Cucumis sativus] gi|449523654|ref|XP_004168838.1| PREDICTED: WD repeat-containing protein 91-like [Cucumis sativus] Length = 207 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +1 Query: 1 RTPALLKISSERDNVNRLKQEIEQLSQKLSQAQTLLEEKDTLLFQLR 141 R PALLK+SSE++ VN LK++I+QL+ KL+Q Q LLEEK+ L LR Sbjct: 77 RIPALLKLSSEKNTVNHLKRDIKQLNLKLAQLQALLEEKEAHLCNLR 123