BLASTX nr result
ID: Scutellaria22_contig00025250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025250 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511504.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002511504.1| conserved hypothetical protein [Ricinus communis] gi|223550619|gb|EEF52106.1| conserved hypothetical protein [Ricinus communis] Length = 1617 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/62 (48%), Positives = 39/62 (62%) Frame = +3 Query: 3 PELQKILNFLIEISHSCGLNRYSEKSNIEXXXXXXXXXXXIMEKIILSQDGSFLVFDEHF 182 P+L+KIL FL E+SH+CGL RYSEK++I I +KI+L+ D S L DE Sbjct: 604 PQLRKILKFLQELSHTCGLGRYSEKNSI-TDDVSAANSSEIKDKIVLNGDASCLYLDESL 662 Query: 183 LP 188 LP Sbjct: 663 LP 664