BLASTX nr result
ID: Scutellaria22_contig00023689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00023689 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323869.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 ref|XP_002533116.1| pentatricopeptide repeat-containing protein,... 62 6e-08 emb|CBI22241.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 >ref|XP_002323869.1| predicted protein [Populus trichocarpa] gi|222866871|gb|EEF04002.1| predicted protein [Populus trichocarpa] Length = 1158 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +2 Query: 2 LGETPSRGAFCSLINKYRSEKNFGKTSKLLKVMQQKGYEPDFDTHW 139 +GETP+R +CS+I+ YR E N K S+L+++MQQ GYEPDFDTHW Sbjct: 1071 VGETPTRLMYCSVIDGYRMENNPRKASELMQMMQQSGYEPDFDTHW 1116 >ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Glycine max] Length = 1186 Score = 62.8 bits (151), Expect = 3e-08 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +2 Query: 5 GETPSRGAFCSLINKYRSEKNFGKTSKLLKVMQQKGYEPDFDTHW 139 GETP+R +C++I Y +KN K S+LL+ MQ+ GY+PDF+THW Sbjct: 1107 GETPTRKMYCTVIKSYHMKKNLRKASELLQAMQENGYQPDFETHW 1151 >ref|XP_002533116.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527079|gb|EEF29261.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1204 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +2 Query: 2 LGETPSRGAFCSLINKYRSEKNFGKTSKLLKVMQQKGYEPDFDTHW 139 LGETP + ++IN+YR E N K S+L+++MQ+ GYEPDFDTHW Sbjct: 1111 LGETPPGKMYSTVINRYRFENNPRKASQLMQMMQRNGYEPDFDTHW 1156 >emb|CBI22241.3| unnamed protein product [Vitis vinifera] Length = 1256 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +2 Query: 2 LGETPSRGAFCSLINKYRSEKNFGKTSKLLKVMQQKGYEPDFDTHW 139 +GETP+R + SLIN+ RSE N K S+LL+ MQ G+ PDF THW Sbjct: 1173 MGETPTREMYTSLINRLRSENNLSKASELLQAMQLSGHAPDFGTHW 1218 >ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Vitis vinifera] Length = 1273 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +2 Query: 2 LGETPSRGAFCSLINKYRSEKNFGKTSKLLKVMQQKGYEPDFDTHW 139 +GETP+R + SLIN+ RSE N K S+LL+ MQ G+ PDF THW Sbjct: 1190 MGETPTREMYTSLINRLRSENNLSKASELLQAMQLSGHAPDFGTHW 1235