BLASTX nr result
ID: Scutellaria22_contig00022293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00022293 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520298.1| calcium binding protein/cast, putative [Rici... 62 4e-08 ref|XP_002285886.1| PREDICTED: probable calcium-binding protein ... 60 1e-07 gb|ABO41848.1| putative calcium-binding protein [Gossypium hirsu... 60 1e-07 ref|XP_002306659.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|NP_001235157.1| uncharacterized protein LOC100527117 [Glycin... 57 2e-06 >ref|XP_002520298.1| calcium binding protein/cast, putative [Ricinus communis] gi|223540517|gb|EEF42084.1| calcium binding protein/cast, putative [Ricinus communis] Length = 165 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -2 Query: 258 RLGLWDKCYGKDCKPMIEVFDANCDGLLDFEEFKNMML 145 RLGLWD+ GKDC MI FD N DG+LDFEEFKNMML Sbjct: 124 RLGLWDEMSGKDCTSMICAFDTNLDGVLDFEEFKNMML 161 >ref|XP_002285886.1| PREDICTED: probable calcium-binding protein CML44-like [Vitis vinifera] Length = 162 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -2 Query: 258 RLGLWDKCYGKDCKPMIEVFDANCDGLLDFEEFKNMMLI 142 RLG+W++ G DC+ MI+V+D N DG+LDFEEFKNMML+ Sbjct: 121 RLGMWEENGGGDCRSMIKVYDTNSDGVLDFEEFKNMMLL 159 >gb|ABO41848.1| putative calcium-binding protein [Gossypium hirsutum] Length = 172 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 258 RLGLWDKCYGKDCKPMIEVFDANCDGLLDFEEFKNMML 145 RLGLWD+ GKDC+ MI +D N DG++DFEEFKNMML Sbjct: 131 RLGLWDEKNGKDCRNMICFYDTNLDGMIDFEEFKNMML 168 >ref|XP_002306659.1| predicted protein [Populus trichocarpa] gi|222856108|gb|EEE93655.1| predicted protein [Populus trichocarpa] Length = 161 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 258 RLGLWDKCYGKDCKPMIEVFDANCDGLLDFEEFKNMML 145 RLGLWD+ GKDC+ MI +D N DG+LDFEEFK MML Sbjct: 120 RLGLWDETTGKDCRSMICRYDTNLDGVLDFEEFKKMML 157 >ref|NP_001235157.1| uncharacterized protein LOC100527117 [Glycine max] gi|255631594|gb|ACU16164.1| unknown [Glycine max] Length = 151 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = -2 Query: 258 RLGLWDKCYGKDCKPMIEVFDANCDGLLDFEEFKNMMLI 142 RLG WD+ + KDC+ MI +D N DG LDF+EFK MML+ Sbjct: 110 RLGFWDQTHAKDCRTMIRFYDTNFDGRLDFQEFKTMMLL 148