BLASTX nr result
ID: Scutellaria22_contig00022234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00022234 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003564808.1| PREDICTED: MLO-like protein 1-like [Brachypo... 55 6e-06 gb|EEE57203.1| hypothetical protein OsJ_07160 [Oryza sativa Japo... 55 6e-06 gb|EAY86311.1| hypothetical protein OsI_07684 [Oryza sativa Indi... 55 6e-06 ref|XP_002533335.1| Protein MLO, putative [Ricinus communis] gi|... 55 8e-06 >ref|XP_003564808.1| PREDICTED: MLO-like protein 1-like [Brachypodium distachyon] Length = 500 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = +1 Query: 43 HSFYITMKYRLIFPDETNFPNRLFQNHSRGNPKFNFYKYMTRAFESDFKKVVGIK 207 HSF + D T H RGNPKF+F+KYM RA E+DFKKVVGI+ Sbjct: 234 HSFVKQFYASVTKSDYTTMRLGFIMTHCRGNPKFDFHKYMVRALEADFKKVVGIR 288 >gb|EEE57203.1| hypothetical protein OsJ_07160 [Oryza sativa Japonica Group] Length = 497 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +1 Query: 121 HSRGNPKFNFYKYMTRAFESDFKKVVGI 204 H RGNPKFNFYKYM RA E DFKKVVGI Sbjct: 257 HCRGNPKFNFYKYMIRALEDDFKKVVGI 284 >gb|EAY86311.1| hypothetical protein OsI_07684 [Oryza sativa Indica Group] Length = 449 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +1 Query: 121 HSRGNPKFNFYKYMTRAFESDFKKVVGI 204 H RGNPKFNFYKYM RA E DFKKVVGI Sbjct: 209 HCRGNPKFNFYKYMIRALEDDFKKVVGI 236 >ref|XP_002533335.1| Protein MLO, putative [Ricinus communis] gi|223526826|gb|EEF29044.1| Protein MLO, putative [Ricinus communis] Length = 507 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/54 (50%), Positives = 31/54 (57%) Frame = +1 Query: 43 HSFYITMKYRLIFPDETNFPNRLFQNHSRGNPKFNFYKYMTRAFESDFKKVVGI 204 HSF+ + D H RGNPKFNF+KYM RA E+DFKKVVGI Sbjct: 229 HSFFKQFYGSVTKSDYITLRLGFIMTHCRGNPKFNFHKYMMRALEADFKKVVGI 282