BLASTX nr result
ID: Scutellaria22_contig00022093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00022093 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_196286.1| spindle pole body component 98 [Arabidopsis tha... 209 1e-52 ref|XP_002309295.1| tubulin gamma complex-associated protein [Po... 209 1e-52 ref|XP_002532346.1| gamma-tubulin complex component, putative [R... 209 2e-52 ref|XP_002275839.1| PREDICTED: gamma-tubulin complex component 3... 209 2e-52 ref|XP_002322735.1| tubulin gamma complex-associated protein [Po... 209 2e-52 >ref|NP_196286.1| spindle pole body component 98 [Arabidopsis thaliana] gi|9759296|dbj|BAB09802.1| gamma-tubulin interacting protein-like [Arabidopsis thaliana] gi|20466522|gb|AAM20578.1| gamma-tubulin interacting protein-like [Arabidopsis thaliana] gi|34365713|gb|AAQ65168.1| At5g06680 [Arabidopsis thaliana] gi|332003666|gb|AED91049.1| spindle pole body component 98 [Arabidopsis thaliana] Length = 838 Score = 209 bits (533), Expect = 1e-52 Identities = 106/117 (90%), Positives = 109/117 (93%) Frame = +2 Query: 5 ELLKVPRATRIMVRKLCELGWLFRKVKGYITESMDRFPAEDVGTVGQAFCAALQDELSDY 184 E +KVPRATRIMVR L ELGWLFRKVK +ITESMDRFPAEDVGTVGQAFCAALQDELSDY Sbjct: 218 ESVKVPRATRIMVRMLSELGWLFRKVKTFITESMDRFPAEDVGTVGQAFCAALQDELSDY 277 Query: 185 YKLLAVLEAQAMNPIPLVSENAGSGNYLSLRRLSVWFTEPMVKMRLMAVLVDSCKVL 355 YKLLAVLEAQAMNPIPLVSE+A S NYLSLRRLSVWF EPMVKMRLMAVLVD CKVL Sbjct: 278 YKLLAVLEAQAMNPIPLVSESASSNNYLSLRRLSVWFAEPMVKMRLMAVLVDKCKVL 334 >ref|XP_002309295.1| tubulin gamma complex-associated protein [Populus trichocarpa] gi|222855271|gb|EEE92818.1| tubulin gamma complex-associated protein [Populus trichocarpa] Length = 860 Score = 209 bits (533), Expect = 1e-52 Identities = 102/115 (88%), Positives = 108/115 (93%) Frame = +2 Query: 11 LKVPRATRIMVRKLCELGWLFRKVKGYITESMDRFPAEDVGTVGQAFCAALQDELSDYYK 190 +KVPR TR+MVRKLCELGWLFRKVKGYI+ESMDRFPAEDVGTVGQAFCAALQDELSDYYK Sbjct: 231 IKVPRGTRVMVRKLCELGWLFRKVKGYISESMDRFPAEDVGTVGQAFCAALQDELSDYYK 290 Query: 191 LLAVLEAQAMNPIPLVSENAGSGNYLSLRRLSVWFTEPMVKMRLMAVLVDSCKVL 355 LLAVLEAQAMNPIPLVS++ S NYLSLRRLSVWF EP VKMRLMAVLVD C+VL Sbjct: 291 LLAVLEAQAMNPIPLVSKSTSSSNYLSLRRLSVWFAEPTVKMRLMAVLVDKCRVL 345 >ref|XP_002532346.1| gamma-tubulin complex component, putative [Ricinus communis] gi|223527963|gb|EEF30048.1| gamma-tubulin complex component, putative [Ricinus communis] Length = 855 Score = 209 bits (532), Expect = 2e-52 Identities = 102/115 (88%), Positives = 109/115 (94%) Frame = +2 Query: 11 LKVPRATRIMVRKLCELGWLFRKVKGYITESMDRFPAEDVGTVGQAFCAALQDELSDYYK 190 +KVP ATR+MVRKLCELGWLFRKVKGYI+ESMDRFPAEDVGTVGQAFCAALQDELS+YYK Sbjct: 226 VKVPTATRLMVRKLCELGWLFRKVKGYISESMDRFPAEDVGTVGQAFCAALQDELSEYYK 285 Query: 191 LLAVLEAQAMNPIPLVSENAGSGNYLSLRRLSVWFTEPMVKMRLMAVLVDSCKVL 355 LLAVLEAQ+MNPIPL+SE A S NYLSLRRLSVWF EPMVKMRLMAVLVD C+VL Sbjct: 286 LLAVLEAQSMNPIPLISEMASSSNYLSLRRLSVWFAEPMVKMRLMAVLVDKCRVL 340 >ref|XP_002275839.1| PREDICTED: gamma-tubulin complex component 3 homolog [Vitis vinifera] Length = 854 Score = 209 bits (531), Expect = 2e-52 Identities = 103/115 (89%), Positives = 108/115 (93%) Frame = +2 Query: 11 LKVPRATRIMVRKLCELGWLFRKVKGYITESMDRFPAEDVGTVGQAFCAALQDELSDYYK 190 +KVPRATRI V+KLCELGWLFRKVKGYI+ESMDRFPAEDVGTVGQAFCAALQDELS YYK Sbjct: 225 IKVPRATRITVQKLCELGWLFRKVKGYISESMDRFPAEDVGTVGQAFCAALQDELSHYYK 284 Query: 191 LLAVLEAQAMNPIPLVSENAGSGNYLSLRRLSVWFTEPMVKMRLMAVLVDSCKVL 355 LLAVLEAQ+MNPIPLVSE A SG YLSLRRLSVWF EPMVKMRLMAVLVD C+VL Sbjct: 285 LLAVLEAQSMNPIPLVSETANSGTYLSLRRLSVWFAEPMVKMRLMAVLVDKCRVL 339 >ref|XP_002322735.1| tubulin gamma complex-associated protein [Populus trichocarpa] gi|222867365|gb|EEF04496.1| tubulin gamma complex-associated protein [Populus trichocarpa] Length = 844 Score = 209 bits (531), Expect = 2e-52 Identities = 102/115 (88%), Positives = 108/115 (93%) Frame = +2 Query: 11 LKVPRATRIMVRKLCELGWLFRKVKGYITESMDRFPAEDVGTVGQAFCAALQDELSDYYK 190 +KVPR TR+MVRKLCELGWLFRKVKGYI+ESMDRFPAEDVGTVGQAFCAALQ+EL DYYK Sbjct: 228 IKVPRGTRVMVRKLCELGWLFRKVKGYISESMDRFPAEDVGTVGQAFCAALQNELLDYYK 287 Query: 191 LLAVLEAQAMNPIPLVSENAGSGNYLSLRRLSVWFTEPMVKMRLMAVLVDSCKVL 355 LLAVLEAQAMNPIPLVSE A SGNYLSLRRL VWF EP+VKMRLMAVLVD C+VL Sbjct: 288 LLAVLEAQAMNPIPLVSETASSGNYLSLRRLLVWFAEPIVKMRLMAVLVDKCRVL 342