BLASTX nr result
ID: Scutellaria22_contig00021837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00021837 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234202.1| NRC1 [Solanum lycopersicum] gi|83630761|gb|A... 67 2e-09 >ref|NP_001234202.1| NRC1 [Solanum lycopersicum] gi|83630761|gb|ABC26878.1| NRC1 [Solanum lycopersicum] Length = 888 Score = 66.6 bits (161), Expect = 2e-09 Identities = 38/74 (51%), Positives = 54/74 (72%), Gaps = 1/74 (1%) Frame = -2 Query: 235 HFPRLRHLNLHNCEKLKEVPIGLADIPNLQHLDL-HSTKLAIASAKEIQDEKQKILKEQG 59 HFPRL+HL++ +C+KL+++PIGLADI +LQ +DL +STK A SA+EIQ +K K+ Q Sbjct: 812 HFPRLKHLHI-SCDKLEKIPIGLADICSLQVMDLRNSTKSAAKSAREIQAKKNKL---QP 867 Query: 58 IVSGVFNLYISPPE 17 S F L + PP+ Sbjct: 868 AKSQKFELSVFPPD 881