BLASTX nr result
ID: Scutellaria22_contig00021489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00021489 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154602.1| PREDICTED: ELMO domain-containing protein A-... 80 1e-13 ref|XP_004139936.1| PREDICTED: ELMO domain-containing protein A-... 80 1e-13 ref|XP_002272217.2| PREDICTED: ELMO domain-containing protein A-... 80 1e-13 ref|XP_002319363.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 gb|AAF86529.1|AC002560_22 F21B7.23 [Arabidopsis thaliana] 75 4e-12 >ref|XP_004154602.1| PREDICTED: ELMO domain-containing protein A-like [Cucumis sativus] Length = 340 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MHASYMDFNEVLQVTRTQLERELSLEDVHRIQDLPAYNML 120 MHASYM+FNEVLQVTRTQLERELSLEDVHRIQDLPAYN+L Sbjct: 299 MHASYMEFNEVLQVTRTQLERELSLEDVHRIQDLPAYNLL 338 >ref|XP_004139936.1| PREDICTED: ELMO domain-containing protein A-like [Cucumis sativus] Length = 233 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MHASYMDFNEVLQVTRTQLERELSLEDVHRIQDLPAYNML 120 MHASYM+FNEVLQVTRTQLERELSLEDVHRIQDLPAYN+L Sbjct: 192 MHASYMEFNEVLQVTRTQLERELSLEDVHRIQDLPAYNLL 231 >ref|XP_002272217.2| PREDICTED: ELMO domain-containing protein A-like [Vitis vinifera] gi|297739246|emb|CBI28897.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MHASYMDFNEVLQVTRTQLERELSLEDVHRIQDLPAYNML 120 MHASYM+FNEVLQVTRTQLERELSLEDVHRIQDLPAYN+L Sbjct: 194 MHASYMEFNEVLQVTRTQLERELSLEDVHRIQDLPAYNLL 233 >ref|XP_002319363.1| predicted protein [Populus trichocarpa] gi|222857739|gb|EEE95286.1| predicted protein [Populus trichocarpa] Length = 239 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 1 MHASYMDFNEVLQVTRTQLERELSLEDVHRIQDLPAYNML 120 M ASYM+FNEVLQVTRTQLERELSLEDVHRI+DLPAYN+L Sbjct: 198 MRASYMEFNEVLQVTRTQLERELSLEDVHRIKDLPAYNLL 237 >gb|AAF86529.1|AC002560_22 F21B7.23 [Arabidopsis thaliana] Length = 248 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 1 MHASYMDFNEVLQVTRTQLERELSLEDVHRIQDLPAYNML 120 MHASYM+FNEVLQ TR QLERELSL+D+HRIQDLPAYN+L Sbjct: 207 MHASYMEFNEVLQATRNQLERELSLDDIHRIQDLPAYNLL 246