BLASTX nr result
ID: Scutellaria22_contig00021478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00021478 (720 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003558232.1| PREDICTED: palmitoyltransferase ZDHHC17-like... 75 1e-11 tpg|DAA44658.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea m... 73 5e-11 tpg|DAA44657.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea m... 73 5e-11 tpg|DAA44654.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea m... 73 5e-11 ref|NP_001148505.1| DHHC zinc finger domain containing protein [... 73 5e-11 >ref|XP_003558232.1| PREDICTED: palmitoyltransferase ZDHHC17-like [Brachypodium distachyon] Length = 313 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = -2 Query: 719 NIKTDEWINWKKYPEFQMKPIPDAGNPQNGARFINPYDKGILRNLREFLSAK 564 NIKTDEWINWKKYPEFQMK P + + +F+NPYDKG+L N+REFL K Sbjct: 265 NIKTDEWINWKKYPEFQMKEEPQS---DSEIKFVNPYDKGMLCNIREFLKPK 313 >tpg|DAA44658.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea mays] Length = 58 Score = 73.2 bits (178), Expect = 5e-11 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -2 Query: 719 NIKTDEWINWKKYPEFQMKPIPDAGNPQNGARFINPYDKGILRNLREFL 573 NIKTDEWINWKKYPEFQMK P + +F+NPYDKG+L N+REFL Sbjct: 10 NIKTDEWINWKKYPEFQMKEQP---RSDSEVKFVNPYDKGMLCNIREFL 55 >tpg|DAA44657.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea mays] Length = 331 Score = 73.2 bits (178), Expect = 5e-11 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -2 Query: 719 NIKTDEWINWKKYPEFQMKPIPDAGNPQNGARFINPYDKGILRNLREFL 573 NIKTDEWINWKKYPEFQMK P + +F+NPYDKG+L N+REFL Sbjct: 283 NIKTDEWINWKKYPEFQMKEQP---RSDSEVKFVNPYDKGMLCNIREFL 328 >tpg|DAA44654.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea mays] Length = 300 Score = 73.2 bits (178), Expect = 5e-11 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -2 Query: 719 NIKTDEWINWKKYPEFQMKPIPDAGNPQNGARFINPYDKGILRNLREFL 573 NIKTDEWINWKKYPEFQMK P + +F+NPYDKG+L N+REFL Sbjct: 252 NIKTDEWINWKKYPEFQMKEQP---RSDSEVKFVNPYDKGMLCNIREFL 297 >ref|NP_001148505.1| DHHC zinc finger domain containing protein [Zea mays] gi|223945801|gb|ACN26984.1| unknown [Zea mays] gi|414866098|tpg|DAA44655.1| TPA: DHHC zinc finger domain containing protein [Zea mays] Length = 315 Score = 73.2 bits (178), Expect = 5e-11 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -2 Query: 719 NIKTDEWINWKKYPEFQMKPIPDAGNPQNGARFINPYDKGILRNLREFL 573 NIKTDEWINWKKYPEFQMK P + +F+NPYDKG+L N+REFL Sbjct: 267 NIKTDEWINWKKYPEFQMKEQP---RSDSEVKFVNPYDKGMLCNIREFL 312