BLASTX nr result
ID: Scutellaria22_contig00021413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00021413 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31619.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_002282470.1| PREDICTED: X-linked retinitis pigmentosa GTP... 64 1e-08 ref|XP_003519358.1| PREDICTED: probable E3 ubiquitin-protein lig... 61 1e-07 ref|XP_002311187.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_003600758.1| RCC1 and BTB domain-containing protein [Medi... 59 5e-07 >emb|CBI31619.3| unnamed protein product [Vitis vinifera] Length = 461 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 130 GEVYTWGWKECIPTGKVIGECSTGSSMEKDAFEKQ 234 GEVYTWGWKEC+P+GKV G+ S G S+EKD FE+Q Sbjct: 101 GEVYTWGWKECVPSGKVFGDPSVGGSLEKDVFERQ 135 >ref|XP_002282470.1| PREDICTED: X-linked retinitis pigmentosa GTPase regulator [Vitis vinifera] Length = 484 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 130 GEVYTWGWKECIPTGKVIGECSTGSSMEKDAFEKQ 234 GEVYTWGWKEC+P+GKV G+ S G S+EKD FE+Q Sbjct: 124 GEVYTWGWKECVPSGKVFGDPSVGGSLEKDVFERQ 158 >ref|XP_003519358.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Glycine max] Length = 477 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 130 GEVYTWGWKECIPTGKVIGECSTGSSMEKD 219 GEVYTWGWKECIP+GKV GE STG S+EKD Sbjct: 120 GEVYTWGWKECIPSGKVFGESSTGVSLEKD 149 >ref|XP_002311187.1| predicted protein [Populus trichocarpa] gi|222851007|gb|EEE88554.1| predicted protein [Populus trichocarpa] Length = 253 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 130 GEVYTWGWKECIPTGKVIGECSTGSSMEKDAFEKQ 234 GEVYTWGWKECIP+GKV + S MEKD FE+Q Sbjct: 121 GEVYTWGWKECIPSGKVFSDPSGAGGMEKDVFERQ 155 >ref|XP_003600758.1| RCC1 and BTB domain-containing protein [Medicago truncatula] gi|355489806|gb|AES71009.1| RCC1 and BTB domain-containing protein [Medicago truncatula] Length = 334 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 130 GEVYTWGWKECIPTGKVIGECSTGSSMEKDA 222 GEVYTWGWKECIP+GKV GE S G S EKDA Sbjct: 117 GEVYTWGWKECIPSGKVFGETSQGVSPEKDA 147