BLASTX nr result
ID: Scutellaria22_contig00021199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00021199 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_198787.1| pentatricopeptide repeat-containing protein [Ar... 84 9e-15 ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containi... 84 1e-14 emb|CBI32451.3| unnamed protein product [Vitis vinifera] 84 1e-14 ref|XP_004159923.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 82 6e-14 ref|XP_004137116.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 >ref|NP_198787.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170916|sp|Q9FIX3.1|PP407_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g39710; AltName: Full=Protein EMBRYO DEFECTIVE 2745 gi|10177971|dbj|BAB11377.1| unnamed protein product [Arabidopsis thaliana] gi|332007083|gb|AED94466.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 747 Score = 84.3 bits (207), Expect = 9e-15 Identities = 43/75 (57%), Positives = 55/75 (73%) Frame = -2 Query: 226 PPNTFLVDKAIAILKRHHPSLLDPLSSQFTPEATANLLLRSQHDQTLILKFLNWARKLPF 47 P ++ L DKA+ LKRH P L LS+ FTPEA +NLLL+SQ+DQ LILKFLNWA F Sbjct: 19 PSDSLLADKALTFLKRH-PYQLHHLSANFTPEAASNLLLKSQNDQALILKFLNWANPHQF 77 Query: 46 FSNQLQCHCLSIHIL 2 F+ L+C C+++HIL Sbjct: 78 FT--LRCKCITLHIL 90 >ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Vitis vinifera] Length = 762 Score = 84.0 bits (206), Expect = 1e-14 Identities = 45/86 (52%), Positives = 56/86 (65%) Frame = -2 Query: 259 SVKLAYPPIPPPPNTFLVDKAIAILKRHHPSLLDPLSSQFTPEATANLLLRSQHDQTLIL 80 S K + + + LVDKAI +LK HP LD LSS+FTP++ + LL+SQ DQTL L Sbjct: 17 SSKARFSSLSSTSHALLVDKAITLLK-FHPHHLDSLSSRFTPQSASYFLLKSQFDQTLTL 75 Query: 79 KFLNWARKLPFFSNQLQCHCLSIHIL 2 KFL WAR PFF + C CLS+HIL Sbjct: 76 KFLTWARNHPFFDS--HCKCLSLHIL 99 >emb|CBI32451.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 84.0 bits (206), Expect = 1e-14 Identities = 45/86 (52%), Positives = 56/86 (65%) Frame = -2 Query: 259 SVKLAYPPIPPPPNTFLVDKAIAILKRHHPSLLDPLSSQFTPEATANLLLRSQHDQTLIL 80 S K + + + LVDKAI +LK HP LD LSS+FTP++ + LL+SQ DQTL L Sbjct: 17 SSKARFSSLSSTSHALLVDKAITLLK-FHPHHLDSLSSRFTPQSASYFLLKSQFDQTLTL 75 Query: 79 KFLNWARKLPFFSNQLQCHCLSIHIL 2 KFL WAR PFF + C CLS+HIL Sbjct: 76 KFLTWARNHPFFDS--HCKCLSLHIL 99 >ref|XP_004159923.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g39710-like [Cucumis sativus] Length = 749 Score = 81.6 bits (200), Expect = 6e-14 Identities = 42/73 (57%), Positives = 53/73 (72%) Frame = -2 Query: 220 NTFLVDKAIAILKRHHPSLLDPLSSQFTPEATANLLLRSQHDQTLILKFLNWARKLPFFS 41 + L DKAI L+RH P L LSS FTP+A++NLLL+SQ D +L+LKFL+WAR FFS Sbjct: 20 DALLADKAIVYLRRH-PEQLTLLSSHFTPQASSNLLLKSQFDSSLVLKFLDWARSQQFFS 78 Query: 40 NQLQCHCLSIHIL 2 QC CL++HIL Sbjct: 79 --FQCKCLALHIL 89 >ref|XP_004137116.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Cucumis sativus] Length = 749 Score = 81.6 bits (200), Expect = 6e-14 Identities = 42/73 (57%), Positives = 53/73 (72%) Frame = -2 Query: 220 NTFLVDKAIAILKRHHPSLLDPLSSQFTPEATANLLLRSQHDQTLILKFLNWARKLPFFS 41 + L DKAI L+RH P L LSS FTP+A++NLLL+SQ D +L+LKFL+WAR FFS Sbjct: 20 DALLADKAIVYLRRH-PEQLTLLSSHFTPQASSNLLLKSQFDSSLVLKFLDWARSQQFFS 78 Query: 40 NQLQCHCLSIHIL 2 QC CL++HIL Sbjct: 79 --FQCKCLALHIL 89