BLASTX nr result
ID: Scutellaria22_contig00021097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00021097 (493 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545255.1| PREDICTED: aspartic proteinase nepenthesin-2... 70 2e-10 ref|XP_002531560.1| Aspartic proteinase nepenthesin-2 precursor,... 67 1e-09 ref|XP_004137780.1| PREDICTED: aspartic proteinase nepenthesin-1... 66 3e-09 emb|CBI30526.3| unnamed protein product [Vitis vinifera] 65 6e-09 ref|XP_002271077.2| PREDICTED: aspartic proteinase nepenthesin-1... 65 7e-09 >ref|XP_003545255.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 427 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = +2 Query: 332 VPKSHASKIFVMPLKTQEMGSPPNKLPFTHNVTLTVSLAVGTPPQNVTMVLDTG 493 V S K ++PLKTQ +PP KL F HNVTLT+SL +G+PPQNVTMVLDTG Sbjct: 27 VSSSQTQKPLLLPLKTQTQ-TPPRKLAFQHNVTLTISLTIGSPPQNVTMVLDTG 79 >ref|XP_002531560.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] gi|223528821|gb|EEF30826.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] Length = 407 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/51 (60%), Positives = 41/51 (80%), Gaps = 5/51 (9%) Frame = +2 Query: 356 IFVMPLKTQEMGS-----PPNKLPFTHNVTLTVSLAVGTPPQNVTMVLDTG 493 + ++PL+T+E+ S PNKLPF HN++LTVSL VGTPPQNV+MV+DTG Sbjct: 1 MLILPLRTEEIPSNSFPRSPNKLPFRHNISLTVSLTVGTPPQNVSMVIDTG 51 >ref|XP_004137780.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus] gi|449483406|ref|XP_004156582.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus] Length = 449 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/56 (58%), Positives = 40/56 (71%), Gaps = 5/56 (8%) Frame = +2 Query: 341 SHASKIFVMPLKTQ-----EMGSPPNKLPFTHNVTLTVSLAVGTPPQNVTMVLDTG 493 S + V+PLKTQ + P+KLPF HN++LTVSL VGTPPQNVTMV+DTG Sbjct: 38 SSLNPALVLPLKTQVIPPESVRRSPDKLPFRHNISLTVSLTVGTPPQNVTMVIDTG 93 >emb|CBI30526.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 65.1 bits (157), Expect = 6e-09 Identities = 35/56 (62%), Positives = 41/56 (73%), Gaps = 5/56 (8%) Frame = +2 Query: 341 SHASKIFVMPLKTQEMGS-----PPNKLPFTHNVTLTVSLAVGTPPQNVTMVLDTG 493 S + + V+PLKTQ + S PNKL F HNV+LTVSL VGTPPQNV+MVLDTG Sbjct: 33 SKSIDMLVLPLKTQVVPSGSFPRSPNKLHFHHNVSLTVSLTVGTPPQNVSMVLDTG 88 >ref|XP_002271077.2| PREDICTED: aspartic proteinase nepenthesin-1-like [Vitis vinifera] Length = 458 Score = 64.7 bits (156), Expect = 7e-09 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 5/51 (9%) Frame = +2 Query: 356 IFVMPLKTQEMGS-----PPNKLPFTHNVTLTVSLAVGTPPQNVTMVLDTG 493 + V+PLKTQ + S PNKL F HNV+LTVSL VGTPPQNV+MVLDTG Sbjct: 55 MLVLPLKTQVVPSGSFPRSPNKLHFHHNVSLTVSLTVGTPPQNVSMVLDTG 105