BLASTX nr result
ID: Scutellaria22_contig00021049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00021049 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD84651.1| CYP81B36 [Scoparia dulcis] 66 3e-09 gb|ABB20892.1| cytochrome P450, partial [Datura metel] 59 4e-07 ref|XP_002866956.1| CYP81D5 [Arabidopsis lyrata subsp. lyrata] g... 57 2e-06 ref|NP_195449.1| cytochrome P450, family 81, subfamily D, polype... 56 4e-06 emb|CAA04116.1| cytochrome P450 [Helianthus tuberosus] 55 6e-06 >gb|ADD84651.1| CYP81B36 [Scoparia dulcis] Length = 502 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -1 Query: 349 DWERAGKELIDMSEGEGLLLPKATPLMAYCKLRSVATHLLS 227 DWER GKEL+DMSEG GL LPKA PLMAYC+ R +A LLS Sbjct: 460 DWERVGKELVDMSEGVGLTLPKAQPLMAYCRARPLAAKLLS 500 >gb|ABB20892.1| cytochrome P450, partial [Datura metel] Length = 74 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 349 DWERAGKELIDMSEGEGLLLPKATPLMAYCKLRSVATHLLS 227 DW+R GKEL+DM+EG GL LPKA PL+A CK R V +LLS Sbjct: 32 DWQRIGKELVDMTEGTGLTLPKAQPLVAKCKPRPVMANLLS 72 >ref|XP_002866956.1| CYP81D5 [Arabidopsis lyrata subsp. lyrata] gi|297312792|gb|EFH43215.1| CYP81D5 [Arabidopsis lyrata subsp. lyrata] Length = 495 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 349 DWERAGKELIDMSEGEGLLLPKATPLMAYCKLRSV 245 +WER G+EL+DM+EGEG+ +PKATPL A CK R+V Sbjct: 456 EWERVGEELVDMTEGEGITMPKATPLRAMCKARAV 490 >ref|NP_195449.1| cytochrome P450, family 81, subfamily D, polypeptide 5 [Arabidopsis thaliana] gi|4376088|emb|CAB16770.1| cytochrome P450-like protein [Arabidopsis thaliana] gi|7270715|emb|CAB80398.1| cytochrome P450-like protein [Arabidopsis thaliana] gi|27754487|gb|AAO22691.1| putative cytochrome p450 family protein [Arabidopsis thaliana] gi|28394071|gb|AAO42443.1| putative cytochrome p450 family protein [Arabidopsis thaliana] gi|332661381|gb|AEE86781.1| cytochrome P450, family 81, subfamily D, polypeptide 5 [Arabidopsis thaliana] Length = 495 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -1 Query: 349 DWERAGKELIDMSEGEGLLLPKATPLMAYCKLRSV 245 +WER G EL+DM+EGEG+ +PKATPL A CK R++ Sbjct: 456 EWERVGAELVDMTEGEGITMPKATPLRAMCKARAI 490 >emb|CAA04116.1| cytochrome P450 [Helianthus tuberosus] Length = 505 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 349 DWERAGKELIDMSEGEGLLLPKATPLMAYCKLRSVATHLLS 227 DWER +EL+DM+EG GL +PKA PL+A CK R T+LLS Sbjct: 463 DWERTSEELVDMTEGPGLTMPKAIPLVAKCKPRVEMTNLLS 503