BLASTX nr result
ID: Scutellaria22_contig00020883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00020883 (718 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD36023.1| transcription factor R18 [Craterostigma plantagi... 59 1e-06 >emb|CAD36023.1| transcription factor R18 [Craterostigma plantagineum] Length = 434 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/58 (44%), Positives = 37/58 (63%) Frame = +3 Query: 15 IPVQQPAFKENWVRPYSQQSHLQNENAARNPPVQQQKCKYFVQGRCYFGDRCKYLHEV 188 I + + F + V P Q+ H+Q+ + RN Q C+Y+ QGRC+FGDRCKYLHE+ Sbjct: 377 INMSRTNFLHHLVHPRDQRQHVQSRDYVRN-----QICRYYAQGRCHFGDRCKYLHEL 429