BLASTX nr result
ID: Scutellaria22_contig00020857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00020857 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001697901.1| hypothetical protein CHLREDRAFT_131686 [Chla... 60 2e-07 gb|AAM65187.1| unknown [Arabidopsis thaliana] 60 2e-07 ref|XP_003635299.1| PREDICTED: protein CbbY-like [Vitis vinifera] 59 3e-07 emb|CBI29443.3| unnamed protein product [Vitis vinifera] 59 3e-07 ref|XP_002532876.1| 2-deoxyglucose-6-phosphate phosphatase, puta... 59 3e-07 >ref|XP_001697901.1| hypothetical protein CHLREDRAFT_131686 [Chlamydomonas reinhardtii] gi|158273999|gb|EDO99784.1| predicted protein [Chlamydomonas reinhardtii] Length = 318 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 208 ASVIKLLSCMLLQDRFQGLDCFLAGDDVKAKKPDPMIYETAA 333 +SV+ L +L + RFQGLDCFLAGDDV KKPDPMIY+ AA Sbjct: 185 SSVVFTLKSLLGEGRFQGLDCFLAGDDVPKKKPDPMIYKVAA 226 >gb|AAM65187.1| unknown [Arabidopsis thaliana] Length = 316 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 208 ASVIKLLSCMLLQDRFQGLDCFLAGDDVKAKKPDPMIYETAA 333 +SVI L +L +RFQGLDCFLAGDDVK KKPDP IY TAA Sbjct: 203 SSVILCLENLLDIERFQGLDCFLAGDDVKEKKPDPSIYITAA 244 >ref|XP_003635299.1| PREDICTED: protein CbbY-like [Vitis vinifera] Length = 328 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 208 ASVIKLLSCMLLQDRFQGLDCFLAGDDVKAKKPDPMIYETA 330 +SVI L ++ +RFQGLDCFLAGDDVK KKPDP IY+TA Sbjct: 215 SSVILCLENLIGIERFQGLDCFLAGDDVKEKKPDPSIYQTA 255 >emb|CBI29443.3| unnamed protein product [Vitis vinifera] Length = 192 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 208 ASVIKLLSCMLLQDRFQGLDCFLAGDDVKAKKPDPMIYETA 330 +SVI L ++ +RFQGLDCFLAGDDVK KKPDP IY+TA Sbjct: 79 SSVILCLENLIGIERFQGLDCFLAGDDVKEKKPDPSIYQTA 119 >ref|XP_002532876.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] gi|223527361|gb|EEF29505.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] Length = 309 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 208 ASVIKLLSCMLLQDRFQGLDCFLAGDDVKAKKPDPMIYETAA 333 +SVI L ++ +RFQGLDCFLAGDDVK KKPDP IY TA+ Sbjct: 196 SSVILCLENLIGMERFQGLDCFLAGDDVKEKKPDPSIYVTAS 237