BLASTX nr result
ID: Scutellaria22_contig00020794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00020794 (507 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532649.1| conserved hypothetical protein [Ricinus comm... 68 7e-10 ref|XP_002276388.1| PREDICTED: uncharacterized protein LOC100245... 57 1e-06 >ref|XP_002532649.1| conserved hypothetical protein [Ricinus communis] gi|223527609|gb|EEF29722.1| conserved hypothetical protein [Ricinus communis] Length = 119 Score = 68.2 bits (165), Expect = 7e-10 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 4/80 (5%) Frame = -3 Query: 229 LVSWAKKELARLKFQSPKR--LMPP--QAQPTFKASSNYINVSSQVSEVVLTADLRCTKC 62 + SWA+KELARLKF P + L+PP QP+ + + SQV EVVL ADLRC C Sbjct: 1 MASWARKELARLKFYKPSKRLLLPPPLNLQPSHDGDDS--STLSQVQEVVLAADLRCATC 58 Query: 61 QERLEAMVSSINNDLESIVV 2 Q+R+ +SSI +D+ES+VV Sbjct: 59 QKRMTDAISSI-DDIESMVV 77 >ref|XP_002276388.1| PREDICTED: uncharacterized protein LOC100245724 [Vitis vinifera] gi|297734194|emb|CBI15441.3| unnamed protein product [Vitis vinifera] Length = 203 Score = 57.4 bits (137), Expect = 1e-06 Identities = 35/78 (44%), Positives = 50/78 (64%) Frame = -3 Query: 235 MTLVSWAKKELARLKFQSPKRLMPPQAQPTFKASSNYINVSSQVSEVVLTADLRCTKCQE 56 MTLVSWAKK L R+ + +L+ PQ T AS + + V E+VL ADL C CQ+ Sbjct: 1 MTLVSWAKKGLNRIGIRQSSKLLLPQ---TSLASIESLE-TPLVQEIVLAADLHCPNCQK 56 Query: 55 RLEAMVSSINNDLESIVV 2 R+ ++S+I +D+ES+VV Sbjct: 57 RVANVISNI-DDMESLVV 73