BLASTX nr result
ID: Scutellaria22_contig00020577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00020577 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514531.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 ref|XP_002311406.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 ref|XP_004160832.1| PREDICTED: uncharacterized LOC101204847 [Cuc... 72 6e-11 ref|XP_004140887.1| PREDICTED: uncharacterized protein LOC101204... 72 6e-11 ref|XP_003571222.1| PREDICTED: uncharacterized protein LOC100830... 72 6e-11 >ref|XP_002514531.1| conserved hypothetical protein [Ricinus communis] gi|223546135|gb|EEF47637.1| conserved hypothetical protein [Ricinus communis] Length = 306 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = +2 Query: 2 YFIFGFLLLLNCGAFVFLLHILYAIFFTRLGLKDSLRLPKWLEAAI 139 Y +FG L+LLN G+FVFLLH+LY++FFTRLG+KDSLRLP+WLE A+ Sbjct: 260 YTLFGILVLLNSGSFVFLLHLLYSVFFTRLGMKDSLRLPRWLEKAL 305 >ref|XP_002311406.1| predicted protein [Populus trichocarpa] gi|222851226|gb|EEE88773.1| predicted protein [Populus trichocarpa] Length = 306 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = +2 Query: 2 YFIFGFLLLLNCGAFVFLLHILYAIFFTRLGLKDSLRLPKWLEAAI 139 Y +FG L++LN G FVFLLH+LY++F TRLG+KDSLRLP+WLE A+ Sbjct: 261 YSLFGILVVLNSGFFVFLLHLLYSVFLTRLGMKDSLRLPRWLEKAL 306 >ref|XP_004160832.1| PREDICTED: uncharacterized LOC101204847 [Cucumis sativus] Length = 469 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +2 Query: 2 YFIFGFLLLLNCGAFVFLLHILYAIFFTRLGLKDSLRLPKWLEAAI 139 Y IFG L+ LNCG F+FLLH+LY+IF TRLGLK SL LP+WLE A+ Sbjct: 424 YAIFGTLVFLNCGCFMFLLHLLYSIFLTRLGLKTSLTLPRWLEKAM 469 >ref|XP_004140887.1| PREDICTED: uncharacterized protein LOC101204847 [Cucumis sativus] Length = 301 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +2 Query: 2 YFIFGFLLLLNCGAFVFLLHILYAIFFTRLGLKDSLRLPKWLEAAI 139 Y IFG L+ LNCG F+FLLH+LY+IF TRLGLK SL LP+WLE A+ Sbjct: 256 YAIFGTLVFLNCGCFMFLLHLLYSIFLTRLGLKTSLTLPRWLEKAM 301 >ref|XP_003571222.1| PREDICTED: uncharacterized protein LOC100830022 [Brachypodium distachyon] Length = 295 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 2 YFIFGFLLLLNCGAFVFLLHILYAIFFTRLGLKDSLRLPKWLE 130 Y IFG LLLLNCG FVF+LHI+Y IF T+LG+K SLRLP+WL+ Sbjct: 231 YVIFGTLLLLNCGFFVFILHIIYTIFLTKLGIKPSLRLPRWLD 273