BLASTX nr result
ID: Scutellaria22_contig00020574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00020574 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517888.1| protein binding protein, putative [Ricinus c... 83 3e-14 ref|XP_002274722.1| PREDICTED: uncharacterized RING finger prote... 76 2e-12 ref|XP_004167319.1| PREDICTED: uncharacterized protein LOC101226... 74 2e-11 ref|XP_004149272.1| PREDICTED: DSC E3 ubiquitin ligase complex s... 74 2e-11 ref|XP_003540369.1| PREDICTED: uncharacterized RING finger prote... 68 9e-10 >ref|XP_002517888.1| protein binding protein, putative [Ricinus communis] gi|223542870|gb|EEF44406.1| protein binding protein, putative [Ricinus communis] Length = 570 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/61 (60%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Frame = -2 Query: 181 LSILFRLVFGLCFIYLAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQELGPFSSWNITGTY 5 L +F+LVFGL F ++ + PV G+RPL++R RSWG+EWL + K+E +LGPFS+WNITGTY Sbjct: 18 LGFVFKLVFGLWFGFVVLRPVAGVRPLKERARSWGDEWLFVKKDENDLGPFSAWNITGTY 77 Query: 4 R 2 R Sbjct: 78 R 78 >ref|XP_002274722.1| PREDICTED: uncharacterized RING finger protein C947.10 [Vitis vinifera] gi|302143312|emb|CBI21873.3| unnamed protein product [Vitis vinifera] Length = 570 Score = 76.3 bits (186), Expect = 2e-12 Identities = 37/73 (50%), Positives = 46/73 (63%), Gaps = 1/73 (1%) Frame = -2 Query: 217 SSEMGSMKSLNLLSILFRLVFGLCFIYLAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQEL 41 ++E G L FR+V GL + + PV GLRPLR R SWG+EWL + K+E L Sbjct: 6 NAEFGWFGRRGRLGFAFRVVLGLWVVLAVLRPVTGLRPLRDRAHSWGDEWLYIRKDENAL 65 Query: 40 GPFSSWNITGTYR 2 GPFS WNITGTY+ Sbjct: 66 GPFSYWNITGTYK 78 >ref|XP_004167319.1| PREDICTED: uncharacterized protein LOC101226239, partial [Cucumis sativus] Length = 291 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/55 (63%), Positives = 43/55 (78%), Gaps = 2/55 (3%) Frame = -2 Query: 160 VFGLCFIY-LAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQELGPFSSWNITGTYR 2 V LC ++ L PV+GLRPLR+R RSWG+EWL + K++ ELGPFS WNITGTYR Sbjct: 24 VIALCVVHCLVSQPVDGLRPLRERARSWGDEWLFVTKDKSELGPFSEWNITGTYR 78 >ref|XP_004149272.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like [Cucumis sativus] Length = 570 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/55 (63%), Positives = 43/55 (78%), Gaps = 2/55 (3%) Frame = -2 Query: 160 VFGLCFIY-LAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQELGPFSSWNITGTYR 2 V LC ++ L PV+GLRPLR+R RSWG+EWL + K++ ELGPFS WNITGTYR Sbjct: 24 VIALCVVHCLVSQPVDGLRPLRERARSWGDEWLFVTKDKSELGPFSEWNITGTYR 78 >ref|XP_003540369.1| PREDICTED: uncharacterized RING finger protein C947.10-like [Glycine max] Length = 570 Score = 67.8 bits (164), Expect = 9e-10 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = -2 Query: 181 LSILFRLVFGLCFIYLAIWPVNGLRPLRQR-RSWGEEWLPLGKEEQELGPFSSWNITGTY 5 L IL R+ F + L + PV GLRPLR+R RSW +E L KEE LGPFS WNITGTY Sbjct: 18 LRILLRVAFWWWVVLLLVNPVAGLRPLRERTRSWDDEGLFTRKEESNLGPFSQWNITGTY 77 Query: 4 R 2 + Sbjct: 78 K 78