BLASTX nr result
ID: Scutellaria22_contig00020517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00020517 (461 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520140.1| conserved hypothetical protein [Ricinus comm... 69 4e-10 ref|XP_002318727.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002322255.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_003526958.1| PREDICTED: uncharacterized protein LOC100820... 59 3e-07 emb|CBI15667.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_002520140.1| conserved hypothetical protein [Ricinus communis] gi|223540632|gb|EEF42195.1| conserved hypothetical protein [Ricinus communis] Length = 246 Score = 68.9 bits (167), Expect = 4e-10 Identities = 41/71 (57%), Positives = 49/71 (69%), Gaps = 1/71 (1%) Frame = -1 Query: 461 KQGLIVAKIP-STNADQNVDAKAPGSPHFTGNNLSNIPKDSELYKAKRSEALRKYEILIE 285 K+GL + P S NA + VD K P S N L+NIPKDS+LY AKR+EALRK+EIL+E Sbjct: 172 KKGLQHTEKPTSPNAHKIVDVKEPAS--IPSNPLNNIPKDSDLYLAKRNEALRKFEILLE 229 Query: 284 LEKQLIPLFGK 252 LEK L P F K Sbjct: 230 LEKTLSPHFSK 240 >ref|XP_002318727.1| predicted protein [Populus trichocarpa] gi|222859400|gb|EEE96947.1| predicted protein [Populus trichocarpa] Length = 253 Score = 64.3 bits (155), Expect = 1e-08 Identities = 36/62 (58%), Positives = 44/62 (70%) Frame = -1 Query: 431 STNADQNVDAKAPGSPHFTGNNLSNIPKDSELYKAKRSEALRKYEILIELEKQLIPLFGK 252 S +NV+ K +P N L+NIPKDSELY AKR+EAL+KYEIL+ELEK+L P F K Sbjct: 189 SPKVQKNVEVKEL-TPVPMFNPLNNIPKDSELYVAKRNEALQKYEILLELEKKLSPHFSK 247 Query: 251 HE 246 E Sbjct: 248 RE 249 >ref|XP_002322255.1| predicted protein [Populus trichocarpa] gi|222869251|gb|EEF06382.1| predicted protein [Populus trichocarpa] Length = 215 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 371 NNLSNIPKDSELYKAKRSEALRKYEILIELEKQLIPLFGK 252 N L+NIPKDSELY AKR+EAL+KYEIL+ELEK+L P F K Sbjct: 170 NPLNNIPKDSELYVAKRNEALQKYEILLELEKKLTPYFSK 209 >ref|XP_003526958.1| PREDICTED: uncharacterized protein LOC100820572 [Glycine max] Length = 242 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/63 (50%), Positives = 43/63 (68%) Frame = -1 Query: 440 KIPSTNADQNVDAKAPGSPHFTGNNLSNIPKDSELYKAKRSEALRKYEILIELEKQLIPL 261 K S ++V K P P + ++SN+PKDS+L+ AKR+EA RKYEIL+ELEK L P+ Sbjct: 176 KDSSLKVQKDVAMKHPAPPPCS--SVSNLPKDSDLFLAKRNEAYRKYEILLELEKLLTPV 233 Query: 260 FGK 252 F K Sbjct: 234 FKK 236 >emb|CBI15667.3| unnamed protein product [Vitis vinifera] Length = 795 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 371 NNLSNIPKDSELYKAKRSEALRKYEILIELEKQLIPLFGK 252 N+ SN+PKD++ Y AKR+EALRK+EIL+ELEKQL LF K Sbjct: 755 NSPSNLPKDNDAYLAKRNEALRKFEILVELEKQLSTLFPK 794