BLASTX nr result
ID: Scutellaria22_contig00020480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00020480 (581 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541465.1| PREDICTED: 4'-phosphopantetheinyl transferas... 62 9e-08 ref|XP_003630431.1| 4'-phosphopantetheinyl transferase [Medicago... 60 2e-07 ref|XP_003630430.1| 4'-phosphopantetheinyl transferase [Medicago... 60 2e-07 ref|XP_002274180.2| PREDICTED: uncharacterized protein LOC100241... 60 3e-07 emb|CBI35888.3| unnamed protein product [Vitis vinifera] 60 3e-07 >ref|XP_003541465.1| PREDICTED: 4'-phosphopantetheinyl transferase-like [Glycine max] Length = 324 Score = 61.6 bits (148), Expect = 9e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 580 YLDILSPCERENVLRMQDEESRKGALLARTLVRTTIAR 467 YL+ILSPCE+EN+ RM+ E+ RKGALLAR LVRTT+AR Sbjct: 48 YLEILSPCEKENIFRMRGEQLRKGALLARALVRTTLAR 85 >ref|XP_003630431.1| 4'-phosphopantetheinyl transferase [Medicago truncatula] gi|355524453|gb|AET04907.1| 4'-phosphopantetheinyl transferase [Medicago truncatula] Length = 303 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 580 YLDILSPCERENVLRMQDEESRKGALLARTLVRTTIARCI 461 Y +ILSPCE+ENVLRM+ EE +K ALLAR LVRTT+AR + Sbjct: 59 YFEILSPCEKENVLRMRGEELKKSALLARALVRTTLARSV 98 >ref|XP_003630430.1| 4'-phosphopantetheinyl transferase [Medicago truncatula] gi|355524452|gb|AET04906.1| 4'-phosphopantetheinyl transferase [Medicago truncatula] Length = 416 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 580 YLDILSPCERENVLRMQDEESRKGALLARTLVRTTIARCI 461 Y +ILSPCE+ENVLRM+ EE +K ALLAR LVRTT+AR + Sbjct: 59 YFEILSPCEKENVLRMRGEELKKSALLARALVRTTLARSV 98 >ref|XP_002274180.2| PREDICTED: uncharacterized protein LOC100241207 [Vitis vinifera] Length = 317 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 580 YLDILSPCERENVLRMQDEESRKGALLARTLVRTTIAR 467 YLDILSPCE+ENVLRM + +K ALLAR LVRTTIAR Sbjct: 52 YLDILSPCEKENVLRMHGDNLKKSALLARALVRTTIAR 89 >emb|CBI35888.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 580 YLDILSPCERENVLRMQDEESRKGALLARTLVRTTIAR 467 YLDILSPCE+ENVLRM + +K ALLAR LVRTTIAR Sbjct: 58 YLDILSPCEKENVLRMHGDNLKKSALLARALVRTTIAR 95