BLASTX nr result
ID: Scutellaria22_contig00020414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00020414 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553987.1| PREDICTED: calcium-binding mitochondrial car... 77 1e-12 ref|XP_003548488.1| PREDICTED: calcium-binding mitochondrial car... 77 1e-12 ref|XP_003602734.1| Calcium-binding mitochondrial carrier protei... 75 7e-12 ref|XP_002318185.1| predicted protein [Populus trichocarpa] gi|2... 74 9e-12 ref|XP_002512812.1| ADP,ATP carrier protein, putative [Ricinus c... 73 2e-11 >ref|XP_003553987.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Glycine max] Length = 477 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 471 KYILHDGEPGPLIQLSCGTISGSLGATCVYPLQVVRTR 358 +YILHDGEPGPL+QL CGT+SG+LGATCVYPLQVVRTR Sbjct: 382 QYILHDGEPGPLVQLGCGTVSGALGATCVYPLQVVRTR 419 >ref|XP_003548488.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Glycine max] Length = 473 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 471 KYILHDGEPGPLIQLSCGTISGSLGATCVYPLQVVRTR 358 +YILHDGEPGPL+QL CGT+SG+LGATCVYPLQVVRTR Sbjct: 378 QYILHDGEPGPLVQLGCGTVSGTLGATCVYPLQVVRTR 415 >ref|XP_003602734.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Medicago truncatula] gi|355491782|gb|AES72985.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Medicago truncatula] Length = 483 Score = 74.7 bits (182), Expect = 7e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 471 KYILHDGEPGPLIQLSCGTISGSLGATCVYPLQVVRTR 358 KYI+HD +PGPL+QL CGTISG+LGATCVYPLQV+RTR Sbjct: 383 KYIIHDSDPGPLVQLGCGTISGTLGATCVYPLQVIRTR 420 >ref|XP_002318185.1| predicted protein [Populus trichocarpa] gi|222858858|gb|EEE96405.1| predicted protein [Populus trichocarpa] Length = 494 Score = 74.3 bits (181), Expect = 9e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 468 YILHDGEPGPLIQLSCGTISGSLGATCVYPLQVVRTR 358 YILHD EPGPL+QL CGTISGS+GATCVYPLQV+RTR Sbjct: 395 YILHDSEPGPLVQLCCGTISGSVGATCVYPLQVIRTR 431 >ref|XP_002512812.1| ADP,ATP carrier protein, putative [Ricinus communis] gi|223547823|gb|EEF49315.1| ADP,ATP carrier protein, putative [Ricinus communis] Length = 469 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 471 KYILHDGEPGPLIQLSCGTISGSLGATCVYPLQVVRTR 358 KYIL D EPGPL+QL CGT+SG+LGATCVYPLQVVRTR Sbjct: 369 KYILRDSEPGPLVQLGCGTLSGALGATCVYPLQVVRTR 406