BLASTX nr result
ID: Scutellaria22_contig00020243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00020243 (494 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] 86 4e-15 gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] 85 5e-15 ref|XP_003618345.1| Cytochrome P450 [Medicago truncatula] gi|355... 78 9e-13 ref|XP_003517268.1| PREDICTED: cytochrome P450 82A3-like [Glycin... 76 3e-12 ref|XP_002522370.1| cytochrome P450, putative [Ricinus communis]... 74 2e-11 >gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] Length = 516 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/59 (67%), Positives = 50/59 (84%) Frame = -1 Query: 494 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDVL 318 PF AGRR+CPG+N G+ M+HL+LA++LQAFDL S+E +DM+ESAG TNIKAT LDVL Sbjct: 447 PFSAGRRICPGTNFGLQMLHLVLASLLQAFDLSRVSNEEIDMSESAGLTNIKATPLDVL 505 >gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] Length = 534 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/59 (64%), Positives = 50/59 (84%) Frame = -1 Query: 494 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDVL 318 PFGAGRR+CPG + G+ M+HL+LA++LQAFD+ SDE +DM+ESAG TN+KAT LDV+ Sbjct: 459 PFGAGRRICPGLSFGLQMLHLVLASLLQAFDMSTVSDEAVDMSESAGLTNMKATPLDVV 517 >ref|XP_003618345.1| Cytochrome P450 [Medicago truncatula] gi|355493360|gb|AES74563.1| Cytochrome P450 [Medicago truncatula] Length = 524 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/59 (57%), Positives = 46/59 (77%) Frame = -1 Query: 494 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDVL 318 PFG+GRR+CPG + G+HM+HL LAN L +F++ GS E +DMTE+ G TN KAT L++L Sbjct: 453 PFGSGRRICPGISFGLHMIHLTLANFLHSFEIVNGSSEPVDMTENLGMTNEKATPLEIL 511 >ref|XP_003517268.1| PREDICTED: cytochrome P450 82A3-like [Glycine max] Length = 530 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/59 (54%), Positives = 49/59 (83%) Frame = -1 Query: 494 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDVL 318 PFG+GRR+CPGS+L + +VH++LA +L +F++ + S++ +DMTES G TN+KAT L+VL Sbjct: 460 PFGSGRRVCPGSSLALRVVHMVLARLLHSFNVASPSNQAVDMTESIGLTNLKATPLEVL 518 >ref|XP_002522370.1| cytochrome P450, putative [Ricinus communis] gi|223538448|gb|EEF40054.1| cytochrome P450, putative [Ricinus communis] Length = 521 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/58 (58%), Positives = 43/58 (74%) Frame = -1 Query: 494 PFGAGRRMCPGSNLGMHMVHLILANILQAFDLRAGSDECLDMTESAGSTNIKATSLDV 321 PFG+GRR CPG LG+ +VH ILA+ L F++ S E +DMTES G TN+KATSL+V Sbjct: 451 PFGSGRRSCPGMALGLQVVHFILASFLHGFEVAKASGENVDMTESTGLTNLKATSLEV 508