BLASTX nr result
ID: Scutellaria22_contig00019489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00019489 (443 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522945.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_002522945.1| conserved hypothetical protein [Ricinus communis] gi|223537757|gb|EEF39375.1| conserved hypothetical protein [Ricinus communis] Length = 477 Score = 58.9 bits (141), Expect = 4e-07 Identities = 36/84 (42%), Positives = 44/84 (52%), Gaps = 6/84 (7%) Frame = +1 Query: 148 DFEPPSFSLGLDFDLQSDPH*TPQPDPVFRPAKRPETAPNLRTIEEDDDFESPVRISDP- 324 D EPPSFSLGLD + + + PQ P T N E+DDDF V SDP Sbjct: 3 DIEPPSFSLGLDLEPEPELPAQPQQHSAISPGPSSSTLLN-DDYEDDDDFGLEVVDSDPE 61 Query: 325 -----PRVLKRLRRGPTAEDRKVK 381 PRV KRLRRGP E+ +++ Sbjct: 62 TGPSSPRVFKRLRRGPAVEESRME 85