BLASTX nr result
ID: Scutellaria22_contig00019212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00019212 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632438.1| PREDICTED: putative disease resistance prote... 58 9e-07 gb|ABF81420.1| NBS type disease resistance protein [Populus tric... 58 9e-07 dbj|BAJ33566.1| CC-NBS-LRR type resistance protein, partial [Cap... 56 3e-06 dbj|BAJ33565.1| CC-NBS-LRR type resistance protein, partial [Cap... 56 3e-06 dbj|BAJ33562.1| CC-NBS-LRR type resistance protein, partial [Cap... 56 3e-06 >ref|XP_003632438.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Length = 966 Score = 57.8 bits (138), Expect = 9e-07 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 1/96 (1%) Frame = -3 Query: 287 LKELDICGCPNLKSIAYRRDG-ESQGLTSLEFLSIRDCPNLISLPSEMLQSSAPSLQTLM 111 L+ L+I GC NL+S+ Y DG + LTSL+ + I DCPNL+S P L +S +L++L Sbjct: 725 LETLNIWGCTNLESL-YIPDGVRNMDLTSLQSIYIWDCPNLVSFPQGGLPAS--NLRSLW 781 Query: 110 LRDLSSLMNLAEIIDCMPKMSSLNSLTIMDVPKLIS 3 +R+ L +L + + + ++SL+ L I+D P+++S Sbjct: 782 IRNCMKLKSLPQRMHTL--LTSLDDLWILDCPEIVS 815 >gb|ABF81420.1| NBS type disease resistance protein [Populus trichocarpa] Length = 1234 Score = 57.8 bits (138), Expect = 9e-07 Identities = 36/95 (37%), Positives = 57/95 (60%) Frame = -3 Query: 287 LKELDICGCPNLKSIAYRRDGESQGLTSLEFLSIRDCPNLISLPSEMLQSSAPSLQTLML 108 LK++ I GCPNL+S++ +TSL L IRDCP+L+S P L +AP++ L L Sbjct: 952 LKQVRIHGCPNLQSLSSHEVARGD-VTSLYSLDIRDCPHLVSFPEGGL--AAPNMTVLRL 1008 Query: 107 RDLSSLMNLAEIIDCMPKMSSLNSLTIMDVPKLIS 3 R+ S + +L E +D + + SL +++ P+L S Sbjct: 1009 RNCSKMKSLPEYMDSL--LPSLVEISLRRCPELES 1041 >dbj|BAJ33566.1| CC-NBS-LRR type resistance protein, partial [Capsicum chacoense] Length = 1315 Score = 55.8 bits (133), Expect = 3e-06 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 8/86 (9%) Frame = -3 Query: 296 LNSLKELDICGCPNLKSIAYRRDGESQGLTSLEFLSIRDCPNLISLP--------SEMLQ 141 LNS++ L I CPNL+S+A ES +SL L+IRDCPNL SLP SE+ Sbjct: 1205 LNSVQSLLIWNCPNLQSLA-----ESALPSSLSKLTIRDCPNLQSLPKSAFPSSLSELTI 1259 Query: 140 SSAPSLQTLMLRDLSSLMNLAEIIDC 63 + P+LQ+L ++ + S +++ I C Sbjct: 1260 ENCPNLQSLPVKGMPSSLSILSICKC 1285 >dbj|BAJ33565.1| CC-NBS-LRR type resistance protein, partial [Capsicum baccatum] Length = 1315 Score = 55.8 bits (133), Expect = 3e-06 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 8/86 (9%) Frame = -3 Query: 296 LNSLKELDICGCPNLKSIAYRRDGESQGLTSLEFLSIRDCPNLISLP--------SEMLQ 141 LNS++ L I CPNL+S+A ES +SL L+IRDCPNL SLP SE+ Sbjct: 1205 LNSVQSLLIWNCPNLQSLA-----ESALPSSLSKLTIRDCPNLQSLPKSAFPSSLSELTI 1259 Query: 140 SSAPSLQTLMLRDLSSLMNLAEIIDC 63 + P+LQ+L ++ + S +++ I C Sbjct: 1260 ENCPNLQSLPVKGMPSSLSILSICKC 1285 >dbj|BAJ33562.1| CC-NBS-LRR type resistance protein, partial [Capsicum annuum] Length = 1315 Score = 55.8 bits (133), Expect = 3e-06 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 8/86 (9%) Frame = -3 Query: 296 LNSLKELDICGCPNLKSIAYRRDGESQGLTSLEFLSIRDCPNLISLP--------SEMLQ 141 LNS++ L I CPNL+S+A ES +SL L+IRDCPNL SLP SE+ Sbjct: 1205 LNSVQSLLIWNCPNLQSLA-----ESALPSSLSKLTIRDCPNLQSLPKSAFPSSLSELTI 1259 Query: 140 SSAPSLQTLMLRDLSSLMNLAEIIDC 63 + P+LQ+L ++ + S +++ I C Sbjct: 1260 ENCPNLQSLPVKGMPSSLSILSIYKC 1285