BLASTX nr result
ID: Scutellaria22_contig00018932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00018932 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] 63 2e-08 >emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] Length = 124 Score = 63.2 bits (152), Expect = 2e-08 Identities = 40/82 (48%), Positives = 41/82 (50%) Frame = -2 Query: 247 LLQAPPNLYKVLLAFSEPLVAYVVVGIPTCSSLPPYLRIQRPPLDVVVTA*AW*ILSEKK 68 LLQAPPNLYKVLLAFS+PLVAYVVVGIPT Sbjct: 9 LLQAPPNLYKVLLAFSQPLVAYVVVGIPT------------------------------- 37 Query: 67 VGFWGSLISTPPVLVRSGPWSS 2 TPPVLVRSG WSS Sbjct: 38 ---------TPPVLVRSGLWSS 50