BLASTX nr result
ID: Scutellaria22_contig00017983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00017983 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_175866.2| Methyltransferase family protein [Arabidopsis t... 121 7e-26 ref|NP_001185226.1| Methyltransferase family protein [Arabidopsi... 121 7e-26 gb|AAC64881.1| Similar to hypothetical protein T1D16.16 gi|30753... 121 7e-26 ref|XP_002319095.1| predicted protein [Populus trichocarpa] gi|2... 120 9e-26 ref|XP_002271187.1| PREDICTED: O-methyltransferase 3-like [Vitis... 120 1e-25 >ref|NP_175866.2| Methyltransferase family protein [Arabidopsis thaliana] gi|28393263|gb|AAO42060.1| unknown protein [Arabidopsis thaliana] gi|56550685|gb|AAV97796.1| At1g54650 [Arabidopsis thaliana] gi|332195009|gb|AEE33130.1| Methyltransferase family protein [Arabidopsis thaliana] Length = 299 Score = 121 bits (303), Expect = 7e-26 Identities = 56/71 (78%), Positives = 62/71 (87%) Frame = +3 Query: 3 MSKAITNCFAVLKPGGALLFRDYGLYDMTMLRFEPEQRIGYREYLRSDGTRSYFFCLDTV 182 M +AI CFAVLKPGG LLFRDYGLYDMTMLRFEPE+R+G+REY+RSDGT SYFFCLDT Sbjct: 195 MPRAIKECFAVLKPGGLLLFRDYGLYDMTMLRFEPEKRVGFREYVRSDGTLSYFFCLDTA 254 Query: 183 RSLASAAGFIE 215 R L + AGFIE Sbjct: 255 RKLFTDAGFIE 265 >ref|NP_001185226.1| Methyltransferase family protein [Arabidopsis thaliana] gi|332195010|gb|AEE33131.1| Methyltransferase family protein [Arabidopsis thaliana] Length = 301 Score = 121 bits (303), Expect = 7e-26 Identities = 56/71 (78%), Positives = 62/71 (87%) Frame = +3 Query: 3 MSKAITNCFAVLKPGGALLFRDYGLYDMTMLRFEPEQRIGYREYLRSDGTRSYFFCLDTV 182 M +AI CFAVLKPGG LLFRDYGLYDMTMLRFEPE+R+G+REY+RSDGT SYFFCLDT Sbjct: 197 MPRAIKECFAVLKPGGLLLFRDYGLYDMTMLRFEPEKRVGFREYVRSDGTLSYFFCLDTA 256 Query: 183 RSLASAAGFIE 215 R L + AGFIE Sbjct: 257 RKLFTDAGFIE 267 >gb|AAC64881.1| Similar to hypothetical protein T1D16.16 gi|3075397 from A. thaliana BAC gb|AC004484 [Arabidopsis thaliana] Length = 325 Score = 121 bits (303), Expect = 7e-26 Identities = 56/71 (78%), Positives = 62/71 (87%) Frame = +3 Query: 3 MSKAITNCFAVLKPGGALLFRDYGLYDMTMLRFEPEQRIGYREYLRSDGTRSYFFCLDTV 182 M +AI CFAVLKPGG LLFRDYGLYDMTMLRFEPE+R+G+REY+RSDGT SYFFCLDT Sbjct: 221 MPRAIKECFAVLKPGGLLLFRDYGLYDMTMLRFEPEKRVGFREYVRSDGTLSYFFCLDTA 280 Query: 183 RSLASAAGFIE 215 R L + AGFIE Sbjct: 281 RKLFTDAGFIE 291 >ref|XP_002319095.1| predicted protein [Populus trichocarpa] gi|222857471|gb|EEE95018.1| predicted protein [Populus trichocarpa] Length = 326 Score = 120 bits (302), Expect = 9e-26 Identities = 56/71 (78%), Positives = 61/71 (85%) Frame = +3 Query: 3 MSKAITNCFAVLKPGGALLFRDYGLYDMTMLRFEPEQRIGYREYLRSDGTRSYFFCLDTV 182 MS AI CF+VLKPGG LLFRDYGLYDMTMLRFE E+R+G+REY+RSDGTRSYFFCLDTV Sbjct: 224 MSSAIMECFSVLKPGGLLLFRDYGLYDMTMLRFEQEKRVGFREYMRSDGTRSYFFCLDTV 283 Query: 183 RSLASAAGFIE 215 R L GFIE Sbjct: 284 RDLFVGVGFIE 294 >ref|XP_002271187.1| PREDICTED: O-methyltransferase 3-like [Vitis vinifera] Length = 193 Score = 120 bits (301), Expect = 1e-25 Identities = 54/71 (76%), Positives = 62/71 (87%) Frame = +3 Query: 3 MSKAITNCFAVLKPGGALLFRDYGLYDMTMLRFEPEQRIGYREYLRSDGTRSYFFCLDTV 182 M AI CF+VLKPGG LLFRDYGLYDMTMLRFEPE+R+G+REY+RSDGTRSYFFC+DTV Sbjct: 91 MPTAIRECFSVLKPGGLLLFRDYGLYDMTMLRFEPEKRVGFREYMRSDGTRSYFFCMDTV 150 Query: 183 RSLASAAGFIE 215 R L + +GF E Sbjct: 151 RDLFTGSGFTE 161