BLASTX nr result
ID: Scutellaria22_contig00017779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00017779 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG09208.1|AF175278_1 wound-inducible P450 hydroxylase [Pisum... 57 2e-06 ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinif... 57 2e-06 ref|XP_003517019.1| PREDICTED: cytochrome P450 82A4-like [Glycin... 57 2e-06 sp|O49859.1|C82A4_SOYBN RecName: Full=Cytochrome P450 82A4; AltN... 57 2e-06 ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis ... 57 2e-06 >gb|AAG09208.1|AF175278_1 wound-inducible P450 hydroxylase [Pisum sativum] Length = 540 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/57 (43%), Positives = 38/57 (66%) Frame = +2 Query: 119 SIRGFFKMMSVFTVSDVVPYLWWVDRVFGGMHKGFRKIGSEFDKMLQEWLEQKKKKR 289 +IR F +++ FTV D VP+L W+D GG K +K +FD+ML EWLE+ ++K+ Sbjct: 236 NIRDFMRLIGTFTVGDGVPFLKWLD--LGGHEKEMKKCAKKFDEMLNEWLEEHREKK 290 >ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinifera] Length = 731 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/56 (46%), Positives = 33/56 (58%) Frame = +2 Query: 122 IRGFFKMMSVFTVSDVVPYLWWVDRVFGGMHKGFRKIGSEFDKMLQEWLEQKKKKR 289 +R FF+ M F VSD +P L W D FGG K RK + D +L+ WL+Q K KR Sbjct: 429 VRDFFQSMGTFLVSDALPLLRWFD--FGGYEKAMRKTAKDLDHLLESWLQQHKSKR 482 >ref|XP_003517019.1| PREDICTED: cytochrome P450 82A4-like [Glycine max] Length = 526 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/53 (45%), Positives = 34/53 (64%) Frame = +2 Query: 131 FFKMMSVFTVSDVVPYLWWVDRVFGGMHKGFRKIGSEFDKMLQEWLEQKKKKR 289 F ++ VFTV D +PYL W+D FGG K ++ E D M+ EWLE+ ++KR Sbjct: 228 FMRLAGVFTVGDAIPYLRWLD--FGGYEKAMKETAKELDVMISEWLEEHRQKR 278 >sp|O49859.1|C82A4_SOYBN RecName: Full=Cytochrome P450 82A4; AltName: Full=Cytochrome P450 CP9 gi|2765093|emb|CAA71877.1| putative cytochrome P450 [Glycine max] Length = 525 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/53 (45%), Positives = 34/53 (64%) Frame = +2 Query: 131 FFKMMSVFTVSDVVPYLWWVDRVFGGMHKGFRKIGSEFDKMLQEWLEQKKKKR 289 F ++ VFTV D +PYL W+D FGG K ++ E D M+ EWLE+ ++KR Sbjct: 228 FMRLAGVFTVGDAIPYLRWLD--FGGYEKAMKETAKELDVMISEWLEEHRQKR 278 >ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera] Length = 525 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/57 (42%), Positives = 38/57 (66%) Frame = +2 Query: 119 SIRGFFKMMSVFTVSDVVPYLWWVDRVFGGMHKGFRKIGSEFDKMLQEWLEQKKKKR 289 +IR FF++M +F VSD +P+L W+D GG K +K E D + QEWLE+ ++++ Sbjct: 225 AIREFFRLMGLFVVSDAIPFLGWLD--VGGHVKAMKKTAKELDGITQEWLEEHRRRK 279