BLASTX nr result
ID: Scutellaria22_contig00017768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00017768 (512 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516502.1| Transcriptional factor TINY, putative [Ricin... 55 6e-06 ref|NP_001239694.1| dehydration-responsive element-binding prote... 55 8e-06 >ref|XP_002516502.1| Transcriptional factor TINY, putative [Ricinus communis] gi|223544322|gb|EEF45843.1| Transcriptional factor TINY, putative [Ricinus communis] Length = 270 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = +1 Query: 64 DLCTTS--EELSEIVELPSLESCFNSVELRNDFVYVENTVLEGWFDSPPPFVADDGGISG 237 DL TT EELSEIVELPSL + + S ELR+DFVYV++ ++GW PP G G Sbjct: 180 DLSTTGPEEELSEIVELPSLGTSYESSELRSDFVYVDS--VDGWVYPPPWLEESHVGGGG 237 Query: 238 C 240 C Sbjct: 238 C 238 >ref|NP_001239694.1| dehydration-responsive element-binding protein 3-like [Glycine max] gi|212717190|gb|ACJ37436.1| AP2 domain-containing transcription factor 2 [Glycine max] Length = 188 Score = 54.7 bits (130), Expect = 8e-06 Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Frame = +1 Query: 64 DLCTTSEELSEIVELPSLESCFN-SVELRNDFVYVENTVLEGWFDSPPPFVADDGGISGC 240 DL + S+ELS+I+ELPSLES + SV+L+ +FV+V++ L+ W PPF D +G Sbjct: 125 DLSSASDELSQIIELPSLESTDDGSVDLKKEFVFVDS--LDAWM-YQPPFGFDTEQDTG- 180 Query: 241 FETLLWNY 264 FE L+WNY Sbjct: 181 FEGLMWNY 188