BLASTX nr result
ID: Scutellaria22_contig00017699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00017699 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526954.1| protein with unknown function [Ricinus commu... 64 1e-08 ref|XP_002300068.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002301724.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_004142774.1| PREDICTED: mitochondrial inner membrane prot... 62 6e-08 tpg|DAA37286.1| TPA: hypothetical protein ZEAMMB73_989264 [Zea m... 61 8e-08 >ref|XP_002526954.1| protein with unknown function [Ricinus communis] gi|223533706|gb|EEF35441.1| protein with unknown function [Ricinus communis] Length = 187 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 478 SEIRAGHLSGDCHYKREFLRGYLKIKGHEQ 389 SEIRAGHLSGDCHYKRE LRGY+KI+GHEQ Sbjct: 114 SEIRAGHLSGDCHYKRELLRGYMKIRGHEQ 143 >ref|XP_002300068.1| predicted protein [Populus trichocarpa] gi|222847326|gb|EEE84873.1| predicted protein [Populus trichocarpa] Length = 187 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 478 SEIRAGHLSGDCHYKREFLRGYLKIKGHEQ 389 SEIRAGHLSGDCHYKRE LRGY+K++GHEQ Sbjct: 114 SEIRAGHLSGDCHYKRELLRGYMKLRGHEQ 143 >ref|XP_002301724.1| predicted protein [Populus trichocarpa] gi|222843450|gb|EEE80997.1| predicted protein [Populus trichocarpa] Length = 174 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 478 SEIRAGHLSGDCHYKREFLRGYLKIKGHEQ 389 SEIRAGHLSGDCHYKRE LRGY+K++GHEQ Sbjct: 101 SEIRAGHLSGDCHYKRELLRGYIKLRGHEQ 130 >ref|XP_004142774.1| PREDICTED: mitochondrial inner membrane protease ATP23-like [Cucumis sativus] gi|449483813|ref|XP_004156699.1| PREDICTED: mitochondrial inner membrane protease ATP23-like [Cucumis sativus] Length = 195 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 478 SEIRAGHLSGDCHYKREFLRGYLKIKGHEQ 389 SEIRAGHLSGDCHYKRE LRG++K++GHEQ Sbjct: 122 SEIRAGHLSGDCHYKRELLRGFMKLRGHEQ 151 >tpg|DAA37286.1| TPA: hypothetical protein ZEAMMB73_989264 [Zea mays] Length = 163 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 478 SEIRAGHLSGDCHYKREFLRGYLKIKGHEQVLL 380 SEIRA HLSGDCHYKRE LRG++KIKGHE V L Sbjct: 128 SEIRANHLSGDCHYKRELLRGFMKIKGHEPVSL 160