BLASTX nr result
ID: Scutellaria22_contig00017644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00017644 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299869.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 >ref|XP_002299869.1| predicted protein [Populus trichocarpa] gi|222847127|gb|EEE84674.1| predicted protein [Populus trichocarpa] Length = 294 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/32 (84%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = -2 Query: 354 EFRTKVEQSISRPGRQWVYGRIYLI-RRRQRW 262 EFRTKVEQ+ SR GRQWVYGRIYL+ RRRQRW Sbjct: 262 EFRTKVEQTTSRVGRQWVYGRIYLVSRRRQRW 293