BLASTX nr result
ID: Scutellaria22_contig00017596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00017596 (641 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274531.2| PREDICTED: uncharacterized protein LOC100257... 53 2e-08 ref|XP_002317005.1| predicted protein [Populus trichocarpa] gi|2... 56 5e-07 ref|XP_002511971.1| conserved hypothetical protein [Ricinus comm... 54 2e-06 >ref|XP_002274531.2| PREDICTED: uncharacterized protein LOC100257817 [Vitis vinifera] Length = 63 Score = 52.8 bits (125), Expect(2) = 2e-08 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +3 Query: 186 RWGYVRIITGTLVGAALGFYYMHRAELKYK 275 +WGY+RI+TGT++G LGFY MHR EL YK Sbjct: 6 KWGYIRIMTGTILGGVLGFYVMHRVELSYK 35 Score = 31.6 bits (70), Expect(2) = 2e-08 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +2 Query: 365 EMWDERLRKYEEELNKSKNQEATSNEFQES 454 EM +ERLRKYE EL KN+E +EF++S Sbjct: 36 EMMNERLRKYECEL---KNREKKLDEFEDS 62 >ref|XP_002317005.1| predicted protein [Populus trichocarpa] gi|222860070|gb|EEE97617.1| predicted protein [Populus trichocarpa] Length = 63 Score = 55.8 bits (133), Expect(2) = 5e-07 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = +3 Query: 171 AMSNPRWGYVRIITGTLVGAALGFYYMHRAELKYK 275 A+++ +WGYVRIITGT++G LGFY MHR E+ YK Sbjct: 2 ALNSQKWGYVRIITGTILGGVLGFYVMHRVEVSYK 36 Score = 23.9 bits (50), Expect(2) = 5e-07 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 365 EMWDERLRKYEEELNKSK 418 E ERLR+YE+EL K + Sbjct: 37 EKMKERLREYEKELQKKE 54 >ref|XP_002511971.1| conserved hypothetical protein [Ricinus communis] gi|223549151|gb|EEF50640.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 53.9 bits (128), Expect(2) = 2e-06 Identities = 21/35 (60%), Positives = 29/35 (82%) Frame = +3 Query: 171 AMSNPRWGYVRIITGTLVGAALGFYYMHRAELKYK 275 A+ + +WGY+RII+GT++G LGFY MHRAE+ YK Sbjct: 2 ALDSLKWGYIRIISGTILGGILGFYVMHRAEVSYK 36 Score = 23.5 bits (49), Expect(2) = 2e-06 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 365 EMWDERLRKYEEELNKSKNQEATSNEF 445 E ERL++YE EL K + + F Sbjct: 37 EKMKERLKQYENELKKKEKLNQLEDSF 63