BLASTX nr result
ID: Scutellaria22_contig00017586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00017586 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22244.3| unnamed protein product [Vitis vinifera] 84 1e-14 ref|XP_002283811.1| PREDICTED: NAC domain-containing protein 100... 84 1e-14 ref|XP_003618528.1| NAC domain protein [Medicago truncatula] gi|... 82 6e-14 gb|AFN55264.1| NAC domain protein [Tamarix hispida] 81 8e-14 gb|AFN55275.1| NAC domain protein [Tamarix hispida] 81 1e-13 >emb|CBI22244.3| unnamed protein product [Vitis vinifera] Length = 290 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -3 Query: 136 DDLMELPPGFRFHPTDEELITHYLSRKVLDSSFSAIAIGEVDMNK 2 D++MELPPGFRFHPTDEELITHYLS+KVL+S F A+AIGEVD+NK Sbjct: 11 DEMMELPPGFRFHPTDEELITHYLSQKVLNSGFCAVAIGEVDLNK 55 >ref|XP_002283811.1| PREDICTED: NAC domain-containing protein 100-like [Vitis vinifera] Length = 363 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -3 Query: 136 DDLMELPPGFRFHPTDEELITHYLSRKVLDSSFSAIAIGEVDMNK 2 D++MELPPGFRFHPTDEELITHYLS+KVL+S F A+AIGEVD+NK Sbjct: 11 DEMMELPPGFRFHPTDEELITHYLSQKVLNSGFCAVAIGEVDLNK 55 >ref|XP_003618528.1| NAC domain protein [Medicago truncatula] gi|355493543|gb|AES74746.1| NAC domain protein [Medicago truncatula] Length = 320 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 136 DDLMELPPGFRFHPTDEELITHYLSRKVLDSSFSAIAIGEVDMNK 2 D+ ELPPGFRFHPTDEELITHYLS+KVLD+SF AIAIGE D+NK Sbjct: 14 DEKFELPPGFRFHPTDEELITHYLSQKVLDNSFCAIAIGEADLNK 58 >gb|AFN55264.1| NAC domain protein [Tamarix hispida] Length = 387 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -3 Query: 142 NRDDLMELPPGFRFHPTDEELITHYLSRKVLDSSFSAIAIGEVDMNK 2 ++++ MELPPGFRFHPTDEELITHYLS KV+D+SFSA AIGEVD+NK Sbjct: 14 DQEERMELPPGFRFHPTDEELITHYLSPKVVDNSFSARAIGEVDLNK 60 >gb|AFN55275.1| NAC domain protein [Tamarix hispida] Length = 390 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -3 Query: 127 MELPPGFRFHPTDEELITHYLSRKVLDSSFSAIAIGEVDMNK 2 MELPPGFRFHPTDEELI+HYLS+KVLDS F+A+AIGEVD+NK Sbjct: 1 MELPPGFRFHPTDEELISHYLSQKVLDSDFTALAIGEVDLNK 42