BLASTX nr result
ID: Scutellaria22_contig00016948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016948 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK96797.1| NAC domain protein NAC2 [Solanum tuberosum] 97 1e-18 gb|AAW28573.2| NAC-domain containing protein 29 , putative [Sola... 97 1e-18 gb|ABI34386.1| NAC-domain containing protein 29 , putative [Sola... 97 1e-18 ref|XP_004135168.1| PREDICTED: NAC transcription factor 29-like ... 94 9e-18 ref|XP_002522466.1| NAC domain-containing protein, putative [Ric... 94 9e-18 >gb|ABK96797.1| NAC domain protein NAC2 [Solanum tuberosum] Length = 282 Score = 97.1 bits (240), Expect = 1e-18 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +1 Query: 241 MVGTYSTDLPPGFRFHPTDEELIMFYLRNQATSRTCPVSIIPEVDIYKFDP 393 MVG S+DLPPGFRFHPTDEELIM+YLR QATSR CPVSIIPE+DIYKFDP Sbjct: 1 MVGKTSSDLPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDIYKFDP 51 >gb|AAW28573.2| NAC-domain containing protein 29 , putative [Solanum demissum] Length = 199 Score = 97.1 bits (240), Expect = 1e-18 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 241 MVGTYSTDLPPGFRFHPTDEELIMFYLRNQATSRTCPVSIIPEVDIYKFDP 393 MVG S+DLPPGFRFHPTDEELIM+YLR QATSR CPVSIIPE+D+YKFDP Sbjct: 1 MVGKISSDLPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDVYKFDP 51 >gb|ABI34386.1| NAC-domain containing protein 29 , putative [Solanum demissum] Length = 194 Score = 97.1 bits (240), Expect = 1e-18 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 241 MVGTYSTDLPPGFRFHPTDEELIMFYLRNQATSRTCPVSIIPEVDIYKFDP 393 MVG S+DLPPGFRFHPTDEELIM+YLR QATSR CPVSIIPE+D+YKFDP Sbjct: 1 MVGKISSDLPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDVYKFDP 51 >ref|XP_004135168.1| PREDICTED: NAC transcription factor 29-like [Cucumis sativus] gi|449530426|ref|XP_004172196.1| PREDICTED: NAC transcription factor 29-like [Cucumis sativus] Length = 290 Score = 94.4 bits (233), Expect = 9e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +1 Query: 259 TDLPPGFRFHPTDEELIMFYLRNQATSRTCPVSIIPEVDIYKFDP 393 T+LPPGFRFHPTDEELIMFYLRNQATS+ CPVSIIPEVDIYKFDP Sbjct: 7 TELPPGFRFHPTDEELIMFYLRNQATSKPCPVSIIPEVDIYKFDP 51 >ref|XP_002522466.1| NAC domain-containing protein, putative [Ricinus communis] gi|223538351|gb|EEF39958.1| NAC domain-containing protein, putative [Ricinus communis] Length = 281 Score = 94.4 bits (233), Expect = 9e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +1 Query: 250 TYSTDLPPGFRFHPTDEELIMFYLRNQATSRTCPVSIIPEVDIYKFDP 393 T +++LPPGFRFHPTDEELIM+YLRNQATSR CPVSIIPEVDIYKFDP Sbjct: 5 TCNSELPPGFRFHPTDEELIMYYLRNQATSRPCPVSIIPEVDIYKFDP 52