BLASTX nr result
ID: Scutellaria22_contig00016729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016729 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152159.1| PREDICTED: ubiquitin thioesterase otubain-li... 56 3e-06 ref|XP_002534741.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_004152159.1| PREDICTED: ubiquitin thioesterase otubain-like [Cucumis sativus] gi|449523221|ref|XP_004168622.1| PREDICTED: ubiquitin thioesterase otubain-like [Cucumis sativus] Length = 302 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 84 VDRIKINVQNCRKTLLSLGYAKFTFEDFFSL 176 VDRIK NV+NCRKTL SLGY +FTFEDFF+L Sbjct: 118 VDRIKTNVENCRKTLRSLGYTEFTFEDFFAL 148 >ref|XP_002534741.1| conserved hypothetical protein [Ricinus communis] gi|223524648|gb|EEF27640.1| conserved hypothetical protein [Ricinus communis] Length = 304 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 84 VDRIKINVQNCRKTLLSLGYAKFTFEDFFSL 176 VDRIK+NV+ CRKTL SLGY FTFEDFF+L Sbjct: 119 VDRIKVNVEECRKTLQSLGYVDFTFEDFFAL 149