BLASTX nr result
ID: Scutellaria22_contig00016720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016720 (532 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] 79 4e-13 ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana... 75 8e-12 gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] ... 74 1e-11 ref|XP_002884538.1| predicted protein [Arabidopsis lyrata subsp.... 74 1e-11 ref|NP_001232820.1| hydrophobic protein LTI6A [Zea mays] gi|1956... 72 4e-11 >gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] Length = 54 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +2 Query: 77 MGTATFVDIIIAILLPPLGVFLKFGCGAEFWICLVLT 187 MGTATF+DIIIAILLPPLGVFLKFGCGAEFWICL+LT Sbjct: 1 MGTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILT 37 >ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] gi|15214251|sp|Q9ZNQ7.1|RCI2A_ARATH RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A gi|6714401|gb|AAF26090.1|AC012393_16 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|13957674|gb|AAK50619.1|AF264749_2 hydrophobic protein RCI2A [Arabidopsis thaliana] gi|4039153|gb|AAC97512.1| low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|4325217|gb|AAD17302.1| hydrophobic protein [Arabidopsis thaliana] gi|14335130|gb|AAK59845.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|14532470|gb|AAK63963.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|18655345|gb|AAL76128.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|332640790|gb|AEE74311.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] Length = 54 Score = 74.7 bits (182), Expect = 8e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 77 MGTATFVDIIIAILLPPLGVFLKFGCGAEFWICLVLT 187 M TATFVDIIIAILLPPLGVFL+FGCG EFWICLVLT Sbjct: 1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLT 37 >gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] gi|388893090|gb|AFK81275.1| rare cold-inducible protein 2A [Camelina sativa] Length = 54 Score = 74.3 bits (181), Expect = 1e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 77 MGTATFVDIIIAILLPPLGVFLKFGCGAEFWICLVLT 187 M TATFVDIIIA+LLPPLGVFL+FGCG EFWICLVLT Sbjct: 1 MSTATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLT 37 >ref|XP_002884538.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330378|gb|EFH60797.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 77 MGTATFVDIIIAILLPPLGVFLKFGCGAEFWICLVLT 187 MGTAT VDIIIAILLPPLGVFL+FGCG EFWICLVLT Sbjct: 1 MGTATCVDIIIAILLPPLGVFLRFGCGVEFWICLVLT 37 >ref|NP_001232820.1| hydrophobic protein LTI6A [Zea mays] gi|195618322|gb|ACG30991.1| hydrophobic protein LTI6A [Zea mays] Length = 56 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 80 GTATFVDIIIAILLPPLGVFLKFGCGAEFWICLVLT 187 GTATF+DII+AI+LPPLGVF KFGCG EFWICL+LT Sbjct: 4 GTATFIDIILAIILPPLGVFFKFGCGVEFWICLILT 39