BLASTX nr result
ID: Scutellaria22_contig00016649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016649 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302770.1| predicted protein [Populus trichocarpa] gi|2... 94 2e-17 ref|XP_003632410.1| PREDICTED: ATP-dependent Clp protease proteo... 91 8e-17 ref|XP_002277104.1| PREDICTED: ATP-dependent Clp protease proteo... 91 8e-17 emb|CAN74592.1| hypothetical protein VITISV_041995 [Vitis vinifera] 91 8e-17 ref|XP_002515273.1| ATP-dependent Clp protease proteolytic subun... 90 2e-16 >ref|XP_002302770.1| predicted protein [Populus trichocarpa] gi|222844496|gb|EEE82043.1| predicted protein [Populus trichocarpa] Length = 300 Score = 93.6 bits (231), Expect = 2e-17 Identities = 52/86 (60%), Positives = 59/86 (68%), Gaps = 10/86 (11%) Frame = -2 Query: 229 HSRYESFRKL---KKSNCKISLNAVY-----APERSSGHDIWSMRDDLQIPSSPYFPVYA 74 H RY R+L +K+ S+ AVY APERS IWSMR+DLQIPSSP+FP YA Sbjct: 35 HLRYSKLRELGSDRKAIQTSSVKAVYSGEFWAPERSLRQGIWSMREDLQIPSSPFFPAYA 94 Query: 73 QGS--QGPPPMVQERFMSVISQLFQH 2 G+ QGPPPMV ERF SVISQLFQH Sbjct: 95 NGAQGQGPPPMVHERFQSVISQLFQH 120 >ref|XP_003632410.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 5, chloroplastic isoform 2 [Vitis vinifera] Length = 215 Score = 91.3 bits (225), Expect = 8e-17 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -2 Query: 163 YAPERSSGHDIWSMRDDLQIPSSPYFPVYAQGSQGPPPMVQERFMSVISQLFQH 2 +AP+++S WS+RDDLQIPSS YFP YAQG QGPPPMVQERF SV+SQLFQH Sbjct: 57 WAPDKNSRQGTWSIRDDLQIPSSAYFPTYAQGGQGPPPMVQERFQSVVSQLFQH 110 >ref|XP_002277104.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 5, chloroplastic isoform 1 [Vitis vinifera] gi|297743987|emb|CBI36957.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 91.3 bits (225), Expect = 8e-17 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -2 Query: 163 YAPERSSGHDIWSMRDDLQIPSSPYFPVYAQGSQGPPPMVQERFMSVISQLFQH 2 +AP+++S WS+RDDLQIPSS YFP YAQG QGPPPMVQERF SV+SQLFQH Sbjct: 57 WAPDKNSRQGTWSIRDDLQIPSSAYFPTYAQGGQGPPPMVQERFQSVVSQLFQH 110 >emb|CAN74592.1| hypothetical protein VITISV_041995 [Vitis vinifera] Length = 429 Score = 91.3 bits (225), Expect = 8e-17 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -2 Query: 163 YAPERSSGHDIWSMRDDLQIPSSPYFPVYAQGSQGPPPMVQERFMSVISQLFQH 2 +AP+++S WS+RDDLQIPSS YFP YAQG QGPPPMVQERF SV+SQLFQH Sbjct: 57 WAPDKNSRQGTWSIRDDLQIPSSAYFPTYAQGGQGPPPMVQERFQSVVSQLFQH 110 >ref|XP_002515273.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] gi|223545753|gb|EEF47257.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] Length = 305 Score = 90.1 bits (222), Expect = 2e-16 Identities = 50/85 (58%), Positives = 59/85 (69%), Gaps = 11/85 (12%) Frame = -2 Query: 223 RYESFRKL---KKSNCKISLNAVY-----APERSSGHDIWSMRDDLQIPSSPYFPVYAQG 68 R FRKL +K++ S AVY APE++S IWS+RDDL+IPSSPYFP YA G Sbjct: 41 RSRKFRKLSSIRKNSQPSSAKAVYSGQFWAPEKTSRQGIWSIRDDLEIPSSPYFPAYANG 100 Query: 67 ---SQGPPPMVQERFMSVISQLFQH 2 +QGPPPMV ERF SVISQLFQ+ Sbjct: 101 QGQAQGPPPMVHERFQSVISQLFQY 125