BLASTX nr result
ID: Scutellaria22_contig00016628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016628 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22241.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_002323869.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_004163793.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 ref|XP_004139757.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 >emb|CBI22241.3| unnamed protein product [Vitis vinifera] Length = 1256 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/59 (55%), Positives = 47/59 (79%) Frame = +3 Query: 3 ASEQTRVFEHLPASCKTMALMLVRVGLCREVECLLSLRESQGILLDCQGVFNSLIEGYV 179 +++Q + F+HLP SC+ MA ML+RVGL REVE LL+ ES+G+LLD +F++L+EGYV Sbjct: 156 SNDQNKGFKHLPQSCEIMASMLIRVGLLREVESLLAEMESRGVLLDGHEIFSNLVEGYV 214 >ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Vitis vinifera] Length = 1273 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/59 (55%), Positives = 47/59 (79%) Frame = +3 Query: 3 ASEQTRVFEHLPASCKTMALMLVRVGLCREVECLLSLRESQGILLDCQGVFNSLIEGYV 179 +++Q + F+HLP SC+ MA ML+RVGL REVE LL+ ES+G+LLD +F++L+EGYV Sbjct: 173 SNDQNKGFKHLPQSCEIMASMLIRVGLLREVESLLAEMESRGVLLDGHEIFSNLVEGYV 231 >ref|XP_002323869.1| predicted protein [Populus trichocarpa] gi|222866871|gb|EEF04002.1| predicted protein [Populus trichocarpa] Length = 1158 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/60 (53%), Positives = 40/60 (66%) Frame = +3 Query: 3 ASEQTRVFEHLPASCKTMALMLVRVGLCREVECLLSLRESQGILLDCQGVFNSLIEGYVG 182 A+EQ + F H P SC+ MA +LVR G+ RE + LL E QGI +D +F SLIEGYVG Sbjct: 59 ANEQDKGFRHFPKSCEVMASILVRHGMFREAQLLLLAMERQGISMDSSKIFVSLIEGYVG 118 >ref|XP_004163793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Cucumis sativus] Length = 1225 Score = 62.4 bits (150), Expect = 4e-08 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = +3 Query: 3 ASEQTRVFEHLPASCKTMALMLVRVGLCREVECLLSLRESQGILLDCQGVFNSLIEGYV 179 A+E + F+HLP SC+ MA +LVRVG +EVE LS ESQGILLD VF+ LI+G V Sbjct: 144 ANESSGNFKHLPRSCEIMASLLVRVGKFKEVEHFLSEMESQGILLDNPEVFSCLIQGLV 202 >ref|XP_004139757.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Cucumis sativus] Length = 1246 Score = 62.4 bits (150), Expect = 4e-08 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = +3 Query: 3 ASEQTRVFEHLPASCKTMALMLVRVGLCREVECLLSLRESQGILLDCQGVFNSLIEGYV 179 A+E + F+HLP SC+ MA +LVRVG +EVE LS ESQGILLD VF+ LI+G V Sbjct: 144 ANESSGNFKHLPRSCEIMASLLVRVGKFKEVEHFLSEMESQGILLDNPEVFSCLIQGLV 202