BLASTX nr result
ID: Scutellaria22_contig00016560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016560 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAH20463.1| cysteine protease [Spinacia oleracea] 67 2e-09 dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus] 65 6e-09 gb|AAK48495.1|AF259983_1 putative cysteine protease [Ipomoea bat... 65 6e-09 dbj|BAD29958.1| cysteine protease [Daucus carota] 65 7e-09 ref|XP_003545327.1| PREDICTED: cysteine proteinase RD21a-like [G... 65 7e-09 >dbj|BAH20463.1| cysteine protease [Spinacia oleracea] Length = 473 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 125 DMSIITYDEQHSVVEKGPGSRSDDEVMSMYESWMVQHGKSYNALGERE 268 DMSII+YD H+++ SRSDDEVM +YESW+VQH K+YNALGE+E Sbjct: 26 DMSIISYDHNHNLLPSS--SRSDDEVMRIYESWLVQHRKNYNALGEKE 71 >dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus] Length = 462 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +2 Query: 125 DMSIITYDEQHSVVEKGPGSRSDDEVMSMYESWMVQHGKSYNALGERE 268 DMSII YD H+ R+DDEVM+MYESW+V+HGKSYNALGE+E Sbjct: 24 DMSIINYDATHASKSSW---RTDDEVMAMYESWLVKHGKSYNALGEKE 68 >gb|AAK48495.1|AF259983_1 putative cysteine protease [Ipomoea batatas] Length = 462 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 125 DMSIITYDEQHSVVEKGPGSRSDDEVMSMYESWMVQHGKSYNALG 259 DMSIITYDE+H KG SRSD+EVM++YESW+V+HGKSYN LG Sbjct: 23 DMSIITYDEEHPA--KGL-SRSDEEVMALYESWLVEHGKSYNGLG 64 >dbj|BAD29958.1| cysteine protease [Daucus carota] Length = 496 Score = 64.7 bits (156), Expect = 7e-09 Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = +2 Query: 125 DMSIITYDEQHSVVEKGPGSRSDDEVMSMYESWMVQHGKSYNALGERE 268 DMSIITYDE H+V G ++DDE +++ESW+V HGKSYNALGE E Sbjct: 21 DMSIITYDETHAV-----GFKTDDEATTLFESWLVTHGKSYNALGEEE 63 >ref|XP_003545327.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max] Length = 496 Score = 64.7 bits (156), Expect = 7e-09 Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = +2 Query: 125 DMSIITYDEQHSVVEKGPGSRSDDEVMSMYESWMVQHGKSYNALGERE 268 DMSII+YD H+ SRSD+E+MSMYE W+V+HGK YNALGE+E Sbjct: 55 DMSIISYDNAHAAT-----SRSDEELMSMYEQWLVKHGKVYNALGEKE 97