BLASTX nr result
ID: Scutellaria22_contig00016271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016271 (534 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI49160.2| SM10-1 [Nicotiana tabacum] gi|238532752|gb|ACR440... 91 1e-16 ref|XP_002311289.1| predicted protein [Populus trichocarpa] gi|2... 88 7e-16 ref|XP_002263696.2| PREDICTED: DCN1-like protein 2-like [Vitis v... 84 1e-14 emb|CBI24165.3| unnamed protein product [Vitis vinifera] 84 1e-14 emb|CAN71094.1| hypothetical protein VITISV_038771 [Vitis vinifera] 84 1e-14 >gb|ABI49160.2| SM10-1 [Nicotiana tabacum] gi|238532752|gb|ACR44084.1| SM10-2 [Nicotiana tabacum] Length = 259 Score = 90.5 bits (223), Expect = 1e-16 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -2 Query: 533 QLLEFARIVDPTLSNYDPDGAWPYLIDEFVDYLTENGILQKGKLNDWSFK 384 QLLEFAR VDP LSNYD +GAWPYLIDEFV+YLTENGI+QKG+++DWS K Sbjct: 209 QLLEFARSVDPALSNYDAEGAWPYLIDEFVEYLTENGIVQKGQMSDWSQK 258 >ref|XP_002311289.1| predicted protein [Populus trichocarpa] gi|222851109|gb|EEE88656.1| predicted protein [Populus trichocarpa] Length = 259 Score = 88.2 bits (217), Expect = 7e-16 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -2 Query: 533 QLLEFARIVDPTLSNYDPDGAWPYLIDEFVDYLTENGILQKGKLNDWSFK 384 QLLEFAR VDPTLSNYD +GAWPYLIDEFV+YL ENGI+QKG+ +WS K Sbjct: 209 QLLEFARTVDPTLSNYDAEGAWPYLIDEFVEYLNENGIMQKGRSTEWSQK 258 >ref|XP_002263696.2| PREDICTED: DCN1-like protein 2-like [Vitis vinifera] Length = 259 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -2 Query: 533 QLLEFARIVDPTLSNYDPDGAWPYLIDEFVDYLTENGILQKGKLNDWSFK 384 QLLEFA+ VDP+LSNYD +GAWPYLIDEFV+YL EN I+QKG+ DWS K Sbjct: 209 QLLEFAKTVDPSLSNYDAEGAWPYLIDEFVEYLNENNIIQKGQPIDWSLK 258 >emb|CBI24165.3| unnamed protein product [Vitis vinifera] Length = 309 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -2 Query: 533 QLLEFARIVDPTLSNYDPDGAWPYLIDEFVDYLTENGILQKGKLNDWSFK 384 QLLEFA+ VDP+LSNYD +GAWPYLIDEFV+YL EN I+QKG+ DWS K Sbjct: 251 QLLEFAKTVDPSLSNYDAEGAWPYLIDEFVEYLNENNIIQKGQPIDWSLK 300 >emb|CAN71094.1| hypothetical protein VITISV_038771 [Vitis vinifera] Length = 265 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -2 Query: 533 QLLEFARIVDPTLSNYDPDGAWPYLIDEFVDYLTENGILQKGKLNDWSFK 384 QLLEFA+ VDP+LSNYD +GAWPYLIDEFV+YL EN I+QKG+ DWS K Sbjct: 215 QLLEFAKTVDPSLSNYDAEGAWPYLIDEFVEYLNENNIIQKGQPIDWSLK 264