BLASTX nr result
ID: Scutellaria22_contig00015336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00015336 (593 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24493.3| unnamed protein product [Vitis vinifera] 131 8e-29 ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containi... 131 8e-29 ref|XP_002864123.1| hypothetical protein ARALYDRAFT_495239 [Arab... 129 4e-28 ref|XP_002510894.1| conserved hypothetical protein [Ricinus comm... 129 4e-28 ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycin... 128 8e-28 >emb|CBI24493.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 131 bits (330), Expect = 8e-29 Identities = 62/78 (79%), Positives = 68/78 (87%) Frame = +2 Query: 149 TASKPRRRMVAVRAESINPSIRKTEEKVVDSVVVTELAKPVTAYCRCWRSGTFPLCDGTH 328 ++S RR V VRAE+INP IRK EEKVVDSV+V ELAKPVTAYCRCWRSGTFPLCDG+H Sbjct: 20 SSSGAARRAVVVRAETINPEIRKIEEKVVDSVLVAELAKPVTAYCRCWRSGTFPLCDGSH 79 Query: 329 LKHNKANEDNVGPLLLKK 382 +KHNKA DNVGPLLLKK Sbjct: 80 VKHNKATGDNVGPLLLKK 97 >ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Vitis vinifera] Length = 117 Score = 131 bits (330), Expect = 8e-29 Identities = 62/78 (79%), Positives = 68/78 (87%) Frame = +2 Query: 149 TASKPRRRMVAVRAESINPSIRKTEEKVVDSVVVTELAKPVTAYCRCWRSGTFPLCDGTH 328 ++S RR V VRAE+INP IRK EEKVVDSV+V ELAKPVTAYCRCWRSGTFPLCDG+H Sbjct: 40 SSSGAARRAVVVRAETINPEIRKIEEKVVDSVLVAELAKPVTAYCRCWRSGTFPLCDGSH 99 Query: 329 LKHNKANEDNVGPLLLKK 382 +KHNKA DNVGPLLLKK Sbjct: 100 VKHNKATGDNVGPLLLKK 117 >ref|XP_002864123.1| hypothetical protein ARALYDRAFT_495239 [Arabidopsis lyrata subsp. lyrata] gi|297309958|gb|EFH40382.1| hypothetical protein ARALYDRAFT_495239 [Arabidopsis lyrata subsp. lyrata] Length = 109 Score = 129 bits (324), Expect = 4e-28 Identities = 62/90 (68%), Positives = 72/90 (80%), Gaps = 4/90 (4%) Frame = +2 Query: 128 YAALSVGTASKPRRRMVAVRAES----INPSIRKTEEKVVDSVVVTELAKPVTAYCRCWR 295 + ++ G + ++RMV VRAE INP IRK EEKVVDSVVVTEL+K +T YCRCWR Sbjct: 20 FKRVTAGEMGQKQQRMVVVRAEGGGGGINPEIRKNEEKVVDSVVVTELSKNITPYCRCWR 79 Query: 296 SGTFPLCDGTHLKHNKANEDNVGPLLLKKQ 385 SGTFPLCDG+H+KHNKAN DNVGPLLLKKQ Sbjct: 80 SGTFPLCDGSHVKHNKANGDNVGPLLLKKQ 109 >ref|XP_002510894.1| conserved hypothetical protein [Ricinus communis] gi|223550009|gb|EEF51496.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 129 bits (324), Expect = 4e-28 Identities = 63/80 (78%), Positives = 72/80 (90%), Gaps = 2/80 (2%) Frame = +2 Query: 152 ASKPRRRMVAVRAES--INPSIRKTEEKVVDSVVVTELAKPVTAYCRCWRSGTFPLCDGT 325 A+KPRR M+AVRAE+ INP+IRK EEKVVDSV+V EL+KP+T YCRCWRSGTFPLCDG+ Sbjct: 31 AAKPRR-MIAVRAEAQGINPAIRKDEEKVVDSVMVAELSKPLTPYCRCWRSGTFPLCDGS 89 Query: 326 HLKHNKANEDNVGPLLLKKQ 385 H+KHNKA DNVGPLLLKKQ Sbjct: 90 HVKHNKATGDNVGPLLLKKQ 109 >ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycine max] gi|255628565|gb|ACU14627.1| unknown [Glycine max] Length = 113 Score = 128 bits (321), Expect = 8e-28 Identities = 63/86 (73%), Positives = 71/86 (82%), Gaps = 2/86 (2%) Frame = +2 Query: 131 AALSVGTASKPRRRMVAVRAE--SINPSIRKTEEKVVDSVVVTELAKPVTAYCRCWRSGT 304 A+ VG RR+V V+AE SINP IRK+EEKVVDSVVVTEL+KP+T YCRCWRSGT Sbjct: 28 ASSFVGVGGVRTRRVVLVKAEAVSINPDIRKSEEKVVDSVVVTELSKPLTPYCRCWRSGT 87 Query: 305 FPLCDGTHLKHNKANEDNVGPLLLKK 382 FPLCDG+H+KHNKA DNVGPLLLKK Sbjct: 88 FPLCDGSHVKHNKATGDNVGPLLLKK 113