BLASTX nr result
ID: Scutellaria22_contig00014965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00014965 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313076.1| predicted protein [Populus trichocarpa] gi|2... 95 7e-18 ref|XP_002330264.1| predicted protein [Populus trichocarpa] gi|2... 92 4e-17 ref|XP_002519123.1| F-box and wd40 domain protein, putative [Ric... 90 2e-16 emb|CBI32524.3| unnamed protein product [Vitis vinifera] 88 8e-16 ref|XP_002281238.1| PREDICTED: vegetative incompatibility protei... 88 8e-16 >ref|XP_002313076.1| predicted protein [Populus trichocarpa] gi|222849484|gb|EEE87031.1| predicted protein [Populus trichocarpa] Length = 424 Score = 94.7 bits (234), Expect = 7e-18 Identities = 43/64 (67%), Positives = 50/64 (78%) Frame = -2 Query: 234 CVWRRDGGGLHSCVSVLTGHGGPVKCLAVERDTAVVEEESDEERLIVYSGCLDNSIKVWR 55 CVWRR+ GG+H C+SVLTGHGGPVKCLAVE D E + ++ IVYSG LD S+KVWR Sbjct: 364 CVWRREAGGVHICLSVLTGHGGPVKCLAVEEDR---ESDKGDQHWIVYSGSLDKSVKVWR 420 Query: 54 VSEN 43 VSEN Sbjct: 421 VSEN 424 >ref|XP_002330264.1| predicted protein [Populus trichocarpa] gi|222871299|gb|EEF08430.1| predicted protein [Populus trichocarpa] Length = 417 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/64 (64%), Positives = 51/64 (79%) Frame = -2 Query: 234 CVWRRDGGGLHSCVSVLTGHGGPVKCLAVERDTAVVEEESDEERLIVYSGCLDNSIKVWR 55 CVWRR+GGG+H+C++VLTGHGGPVKCLAV D E + ++R IVYSG LD S+KVW Sbjct: 357 CVWRREGGGVHTCLAVLTGHGGPVKCLAVVEDQ---ESDEGDQRWIVYSGSLDKSVKVWC 413 Query: 54 VSEN 43 V+EN Sbjct: 414 VTEN 417 >ref|XP_002519123.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223541786|gb|EEF43334.1| F-box and wd40 domain protein, putative [Ricinus communis] Length = 448 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/69 (63%), Positives = 50/69 (72%), Gaps = 4/69 (5%) Frame = -2 Query: 234 CVWRRDGGGLHSCVSVLTGHGGPVKCLAV----ERDTAVVEEESDEERLIVYSGCLDNSI 67 CVWRR+ GG+H C+SVLTGHGGPVKCLAV E D + + R IVYSG LD S+ Sbjct: 375 CVWRREPGGIHICLSVLTGHGGPVKCLAVGEDHESDHDPRGSDRGDHRWIVYSGSLDKSV 434 Query: 66 KVWRVSENA 40 KVWRVSENA Sbjct: 435 KVWRVSENA 443 >emb|CBI32524.3| unnamed protein product [Vitis vinifera] Length = 429 Score = 87.8 bits (216), Expect = 8e-16 Identities = 42/65 (64%), Positives = 50/65 (76%) Frame = -2 Query: 234 CVWRRDGGGLHSCVSVLTGHGGPVKCLAVERDTAVVEEESDEERLIVYSGCLDNSIKVWR 55 CVWRR+GG +H+C+SVLTGH GPVKCLAVE D E ++R IVYSG LD S+K+WR Sbjct: 346 CVWRREGG-IHTCLSVLTGHTGPVKCLAVEEDQ---ESTKRDQRWIVYSGSLDKSVKIWR 401 Query: 54 VSENA 40 VSE A Sbjct: 402 VSEQA 406 >ref|XP_002281238.1| PREDICTED: vegetative incompatibility protein HET-E-1-like [Vitis vinifera] Length = 445 Score = 87.8 bits (216), Expect = 8e-16 Identities = 42/65 (64%), Positives = 50/65 (76%) Frame = -2 Query: 234 CVWRRDGGGLHSCVSVLTGHGGPVKCLAVERDTAVVEEESDEERLIVYSGCLDNSIKVWR 55 CVWRR+GG +H+C+SVLTGH GPVKCLAVE D E ++R IVYSG LD S+K+WR Sbjct: 362 CVWRREGG-IHTCLSVLTGHTGPVKCLAVEEDQ---ESTKRDQRWIVYSGSLDKSVKIWR 417 Query: 54 VSENA 40 VSE A Sbjct: 418 VSEQA 422