BLASTX nr result
ID: Scutellaria22_contig00014956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00014956 (469 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515470.1| calcium ion binding protein, putative [Ricin... 64 2e-08 ref|XP_003631765.1| PREDICTED: calcium uptake protein 1, mitocho... 62 5e-08 ref|NP_194934.1| EF-hand, calcium binding motif-containing prote... 60 2e-07 ref|XP_002869294.1| calcium-binding EF hand family protein [Arab... 60 2e-07 ref|NP_001078476.1| EF-hand, calcium binding motif-containing pr... 60 2e-07 >ref|XP_002515470.1| calcium ion binding protein, putative [Ricinus communis] gi|223545414|gb|EEF46919.1| calcium ion binding protein, putative [Ricinus communis] Length = 540 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +2 Query: 374 NYESKFLFGEAYRRKIFFNYEKRIRMRSPPEK 469 +Y SKF+FG+AYRRKIFFNYEKRIR+RSPPEK Sbjct: 108 DYSSKFIFGDAYRRKIFFNYEKRIRLRSPPEK 139 >ref|XP_003631765.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Vitis vinifera] gi|296082107|emb|CBI21112.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 386 KFLFGEAYRRKIFFNYEKRIRMRSPPEK 469 KFLFGEAYRRKIFFNYEKRIRMRSPPEK Sbjct: 103 KFLFGEAYRRKIFFNYEKRIRMRSPPEK 130 >ref|NP_194934.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] gi|2827631|emb|CAA16584.1| putative protein [Arabidopsis thaliana] gi|7270110|emb|CAB79924.1| putative protein [Arabidopsis thaliana] gi|18176110|gb|AAL59985.1| unknown protein [Arabidopsis thaliana] gi|21689743|gb|AAM67515.1| unknown protein [Arabidopsis thaliana] gi|332660599|gb|AEE85999.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] Length = 498 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 9/66 (13%) Frame = +2 Query: 299 SFADCPPPAPATAVAGLSQSSLQNKN---------YESKFLFGEAYRRKIFFNYEKRIRM 451 SFAD P+ V G+ L+ ++ Y S F+FG+AYRRKIFFNYEKR+R+ Sbjct: 97 SFADSSTPS----VCGVKVGDLKPRSFIPKLSLPGYSSGFIFGDAYRRKIFFNYEKRLRL 152 Query: 452 RSPPEK 469 +SPPEK Sbjct: 153 QSPPEK 158 >ref|XP_002869294.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297315130|gb|EFH45553.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] Length = 496 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/62 (53%), Positives = 39/62 (62%), Gaps = 5/62 (8%) Frame = +2 Query: 299 SFADCPPPAPATAVAG-LSQSSLQNK----NYESKFLFGEAYRRKIFFNYEKRIRMRSPP 463 SFAD P+ G L S K Y S F+FG+AYRRKIFFNYEKR+R++SPP Sbjct: 97 SFADSSSPSVCGVKVGDLKPRSFLPKLSLPGYSSGFIFGDAYRRKIFFNYEKRLRLQSPP 156 Query: 464 EK 469 EK Sbjct: 157 EK 158 >ref|NP_001078476.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] gi|332660600|gb|AEE86000.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] Length = 454 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 9/66 (13%) Frame = +2 Query: 299 SFADCPPPAPATAVAGLSQSSLQNKN---------YESKFLFGEAYRRKIFFNYEKRIRM 451 SFAD P+ V G+ L+ ++ Y S F+FG+AYRRKIFFNYEKR+R+ Sbjct: 97 SFADSSTPS----VCGVKVGDLKPRSFIPKLSLPGYSSGFIFGDAYRRKIFFNYEKRLRL 152 Query: 452 RSPPEK 469 +SPPEK Sbjct: 153 QSPPEK 158