BLASTX nr result
ID: Scutellaria22_contig00014947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00014947 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] 71 8e-11 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum] 66 3e-09 ref|XP_003543171.1| PREDICTED: secologanin synthase-like [Glycin... 65 8e-09 emb|CBI22134.3| unnamed protein product [Vitis vinifera] 65 8e-09 ref|XP_002270326.1| PREDICTED: secologanin synthase [Vitis vinif... 65 8e-09 >dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] Length = 518 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +1 Query: 1 ALAMILQRFSFELSSSYLHAPFPIITLQPQHGATLLLHKL 120 A+AMILQRFSFELSS+Y+HAP+ +ITLQPQHGA L+LHKL Sbjct: 479 AIAMILQRFSFELSSTYVHAPYTVITLQPQHGAQLILHKL 518 >gb|ABC69414.1| CYP72A57 [Nicotiana tabacum] Length = 518 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 ALAMILQRFSFELSSSYLHAPFPIITLQPQHGATLLLHKL 120 ALAMILQRFSFELS SY HAP I+T+QPQHGA L+LHK+ Sbjct: 479 ALAMILQRFSFELSPSYAHAPQSILTMQPQHGAPLILHKI 518 >ref|XP_003543171.1| PREDICTED: secologanin synthase-like [Glycine max] Length = 537 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 1 ALAMILQRFSFELSSSYLHAPFPIITLQPQHGATLLLHKL 120 AL+MILQRFSFELS +Y HAP +ITLQPQHGA L+LHK+ Sbjct: 496 ALSMILQRFSFELSPTYTHAPTSVITLQPQHGAHLILHKV 535 >emb|CBI22134.3| unnamed protein product [Vitis vinifera] Length = 529 Score = 64.7 bits (156), Expect = 8e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 ALAMILQRFSFELSSSYLHAPFPIITLQPQHGATLLLHKL 120 ALAMILQRFSFELS SY HAPF +IT+QPQ+GA L+LH L Sbjct: 490 ALAMILQRFSFELSPSYAHAPFNVITVQPQYGAHLILHGL 529 >ref|XP_002270326.1| PREDICTED: secologanin synthase [Vitis vinifera] Length = 516 Score = 64.7 bits (156), Expect = 8e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 ALAMILQRFSFELSSSYLHAPFPIITLQPQHGATLLLHKL 120 ALAMILQRFSFELS SY HAPF +IT+QPQ+GA L+LH L Sbjct: 477 ALAMILQRFSFELSPSYAHAPFNVITVQPQYGAHLILHGL 516