BLASTX nr result
ID: Scutellaria22_contig00014776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00014776 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [... 74 1e-11 ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arab... 74 1e-11 sp|P19173.3|COX5C_IPOBA RecName: Full=Cytochrome c oxidase subun... 72 4e-11 ref|XP_002524666.1| Cytochrome c oxidase polypeptide Vc-2, putat... 68 9e-10 sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subun... 65 8e-09 >ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana] gi|48428152|sp|Q9FNE0.1|CX5C4_ARATH RecName: Full=Putative cytochrome c oxidase subunit 5C-4; AltName: Full=Cytochrome c oxidase polypeptide Vc-4 gi|10178149|dbj|BAB11594.1| cytochrome c oxidase Vc subunit [Arabidopsis thaliana] gi|332007158|gb|AED94541.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana] Length = 65 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/58 (60%), Positives = 37/58 (63%) Frame = +2 Query: 62 GHVVYKGPSXXXXXXXXXXXXXXXXXFWKMHHWSNQRRTREFYDLLEKGEISVVREDE 235 G VYKGPS WKMHHW+NQRRT+EFYDLLEKGEISVV EDE Sbjct: 8 GKAVYKGPSVVKEIIYGITLGFAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVVEDE 65 >ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. lyrata] gi|297314493|gb|EFH44916.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. lyrata] Length = 65 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/58 (60%), Positives = 37/58 (63%) Frame = +2 Query: 62 GHVVYKGPSXXXXXXXXXXXXXXXXXFWKMHHWSNQRRTREFYDLLEKGEISVVREDE 235 G VYKGPS WKMHHW+NQRRT+EFYDLLEKGEISVV EDE Sbjct: 8 GKAVYKGPSVVKEIIYGITLGLAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVVEDE 65 >sp|P19173.3|COX5C_IPOBA RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome c oxidase polypeptide Vc gi|58368|emb|CAA37470.1| unnamed protein product [Ipomoea batatas] gi|688313|gb|AAB31231.1| cytochrome c oxidase subunit Vc [Ipomoea batatas] Length = 64 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/62 (54%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = +2 Query: 59 GGHV---VYKGPSXXXXXXXXXXXXXXXXXFWKMHHWSNQRRTREFYDLLEKGEISVVRE 229 GGHV VYKGPS FWKMHHW++QRRT+EFYD+LEKG+ISVV + Sbjct: 3 GGHVAHLVYKGPSVVKELVIGFSLGLVAGGFWKMHHWNSQRRTKEFYDMLEKGQISVVAD 62 Query: 230 DE 235 +E Sbjct: 63 EE 64 >ref|XP_002524666.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis] gi|223536027|gb|EEF37685.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis] Length = 65 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/61 (50%), Positives = 35/61 (57%) Frame = +2 Query: 53 RMGGHVVYKGPSXXXXXXXXXXXXXXXXXFWKMHHWSNQRRTREFYDLLEKGEISVVRED 232 R H Y GPS WKMHHW+NQ+R +EFYDLLE+GEISVV ED Sbjct: 5 RKVAHAAYNGPSIIKEIIYGISLGLGAGLLWKMHHWNNQKRAKEFYDLLERGEISVVVED 64 Query: 233 E 235 E Sbjct: 65 E 65 >sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 gi|18409602|gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus] Length = 64 Score = 64.7 bits (156), Expect = 8e-09 Identities = 33/64 (51%), Positives = 37/64 (57%), Gaps = 4/64 (6%) Frame = +2 Query: 56 MGG----HVVYKGPSXXXXXXXXXXXXXXXXXFWKMHHWSNQRRTREFYDLLEKGEISVV 223 MGG H V KGPS WKMHHW+ QR+TR FYDLLEKGEISVV Sbjct: 1 MGGGRVAHPVLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVV 60 Query: 224 REDE 235 ++E Sbjct: 61 VDEE 64