BLASTX nr result
ID: Scutellaria22_contig00014752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00014752 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270988.2| PREDICTED: threonyl-tRNA synthetase-like [Vi... 72 6e-11 emb|CBI28402.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_003601575.1| Threonyl-tRNA synthetase [Medicago truncatul... 71 8e-11 ref|XP_002532001.1| threonyl-tRNA synthetase, putative [Ricinus ... 70 2e-10 gb|ADK92877.1| threonyl-tRNA synthetase [Hypericum perforatum] 67 1e-09 >ref|XP_002270988.2| PREDICTED: threonyl-tRNA synthetase-like [Vitis vinifera] Length = 670 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 392 SEKLKIPLMGVVGPKEVETQTVTVRSRLGGELGTMGIDDFIS 267 SEK +IPLM VVGPKEVETQTVTVRSR GGELGTM ++DFIS Sbjct: 617 SEKQRIPLMAVVGPKEVETQTVTVRSRFGGELGTMIVEDFIS 658 >emb|CBI28402.3| unnamed protein product [Vitis vinifera] Length = 688 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 392 SEKLKIPLMGVVGPKEVETQTVTVRSRLGGELGTMGIDDFIS 267 SEK +IPLM VVGPKEVETQTVTVRSR GGELGTM ++DFIS Sbjct: 635 SEKQRIPLMAVVGPKEVETQTVTVRSRFGGELGTMIVEDFIS 676 >ref|XP_003601575.1| Threonyl-tRNA synthetase [Medicago truncatula] gi|355490623|gb|AES71826.1| Threonyl-tRNA synthetase [Medicago truncatula] Length = 690 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 392 SEKLKIPLMGVVGPKEVETQTVTVRSRLGGELGTMGIDDFIS 267 +EK KIPLM VVG KE+ETQTVTVRSR GGELGTM +DDFIS Sbjct: 637 AEKQKIPLMAVVGSKEIETQTVTVRSRFGGELGTMSVDDFIS 678 >ref|XP_002532001.1| threonyl-tRNA synthetase, putative [Ricinus communis] gi|223528332|gb|EEF30374.1| threonyl-tRNA synthetase, putative [Ricinus communis] Length = 658 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 392 SEKLKIPLMGVVGPKEVETQTVTVRSRLGGELGTMGIDDFIS 267 +EK KIPLM VVGPKEVETQ+VT+RSR GELGTM IDDFIS Sbjct: 605 AEKQKIPLMAVVGPKEVETQSVTIRSRFSGELGTMTIDDFIS 646 >gb|ADK92877.1| threonyl-tRNA synthetase [Hypericum perforatum] Length = 721 Score = 67.4 bits (163), Expect = 1e-09 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 392 SEKLKIPLMGVVGPKEVETQTVTVRSRLGGELGTMGIDDFIS 267 +EK K+PLM VVGPKEVETQTVTVRSR G++GT+ IDDFIS Sbjct: 668 AEKQKVPLMAVVGPKEVETQTVTVRSRSSGDVGTIDIDDFIS 709