BLASTX nr result
ID: Scutellaria22_contig00014719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00014719 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283224.1| PREDICTED: G-type lectin S-receptor-like ser... 57 1e-06 emb|CAN59769.1| hypothetical protein VITISV_011720 [Vitis vinifera] 57 1e-06 ref|XP_002299254.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002283204.1| PREDICTED: G-type lectin S-receptor-like ser... 56 3e-06 emb|CBI16443.3| unnamed protein product [Vitis vinifera] 55 8e-06 >ref|XP_002283224.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Vitis vinifera] Length = 816 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -1 Query: 270 RCPNGYSWIDPNDMMSGCKQDFVPQSCDRESEESNLF 160 +CP GY+++DP+D GCKQ+FVPQSC++ES E+N F Sbjct: 327 KCPPGYTFLDPHDEKKGCKQNFVPQSCNQESRETNEF 363 >emb|CAN59769.1| hypothetical protein VITISV_011720 [Vitis vinifera] Length = 767 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -1 Query: 270 RCPNGYSWIDPNDMMSGCKQDFVPQSCDRESEESNLF 160 +CP GY+++DP+D GCKQ+FVPQSC++ES E+N F Sbjct: 327 KCPPGYTFLDPHDEKKGCKQNFVPQSCNQESRETNEF 363 >ref|XP_002299254.1| predicted protein [Populus trichocarpa] gi|222846512|gb|EEE84059.1| predicted protein [Populus trichocarpa] Length = 812 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = -1 Query: 267 CPNGYSWIDPNDMMSGCKQDFVPQSCDRESEESNLF 160 CP GY+++DPND+M GCKQ+FV Q+C+ S+E+ LF Sbjct: 331 CPPGYTFLDPNDVMKGCKQNFVSQNCEEASQETELF 366 >ref|XP_002283204.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Vitis vinifera] Length = 804 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = -1 Query: 270 RCPNGYSWIDPNDMMSGCKQDFVPQSCDRESEESNLF 160 +CP Y+++DP D MSGCKQ+FVP+SC ES+E LF Sbjct: 325 QCPPRYTFLDPQDDMSGCKQNFVPESCSEESQEKGLF 361 >emb|CBI16443.3| unnamed protein product [Vitis vinifera] Length = 1367 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = -1 Query: 270 RCPNGYSWIDPNDMMSGCKQDFVPQSCDRESEESNLF 160 +CP GYS++D + M GCKQDFVP+SCD +S++ LF Sbjct: 453 QCPPGYSFLDQKNEMKGCKQDFVPESCDEKSQKMGLF 489